Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

LRRC4 Rabbit pAb (A10321)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - LRRC4 Rabbit pAb (A10321)

Western blot analysis of extracts of various cell lines, using LRRC4 antibody (A10321) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

You may also interested in:

Overview

Product name LRRC4 Rabbit pAb
Catalog No. A10321
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to be involved in modulation of chemical synaptic transmission and synapse organization. Predicted to act upstream of or within synapse organization. Predicted to be located in neuron spine and postsynaptic membrane. Predicted to be active in Schaffer collateral - CA1 synapse; glutamatergic synapse; and plasma membrane. Predicted to be integral component of postsynaptic density membrane.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 544-653 of human LRRC4 (NP_071426.1).
Sequence LIVFYKLRKRHQQRSTVTAARTVEIIQVDEDIPAATSAAATAAPSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI
Gene ID 64101
Swiss prot Q9HBW1
Synonyms NAG14; NGL-2; LRRC4
Calculated MW 73kDa
Observed MW 73kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-87MG, U-251MG, K-562, Mouse brain, Mouse liver, Rat brain, Rat liver
Cellular location Cell junction, Membrane, Single-pass type I membrane protein, postsynaptic cell membrane, synapse
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

LRRC4 Rabbit pAb images

ABclonal:Western blot - LRRC4 Rabbit pAb (A10321)}

Western blot - LRRC4 Rabbit pAb (A10321)

Western blot analysis of extracts of various cell lines, using LRRC4 antibody (A10321) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Inquire About This Product

Submit your question about A10321 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on LRRC4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to LRRC4. (Distance between topics and target gene indicate popularity.) LRRC4

* Data provided by citexs.com, for reference only.

Publishing research using A10321? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order