Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

LRG1 Rabbit pAb (A7850)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - LRG1 Rabbit pAb (A7850)

Western blot analysis of lysates from Human plasma, using LRG1 Rabbit pAb (A7850) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - LRG1 Rabbit pAb (A7850)

Immunofluorescence analysis of paraffin-embedded rat liver using LRG1 Rabbit pAb (A7850) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - LRG1 Rabbit pAb (A7850)

Immunofluorescence analysis of paraffin-embedded human liver using LRG1 Rabbit pAb (A7850) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - LRG1 Rabbit pAb (A7850)

Immunofluorescence analysis of paraffin-embedded mouse liver using LRG1 Rabbit pAb (A7850) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name LRG1 Rabbit pAb
Catalog No. A7850
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (O'Donnell et al., 2002 [PubMed 12223515]).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 36-347 of human LRG1 (NP_443204.1).
Sequence VTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
Gene ID 116844
Swiss prot P02750
Synonyms LRG; HMFT1766; LRG1
Calculated MW 38kDa
Observed MW 45kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Human plasma
Cellular location Secreted
Customer validation

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

LRG1 Rabbit pAb images

ABclonal:Western blot - LRG1 Rabbit pAb (A7850)}

Western blot - LRG1 Rabbit pAb (A7850)

Western blot analysis of lysates from Human plasma, using LRG1 Rabbit pAb (A7850) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunofluorescence - LRG1 Rabbit pAb (A7850)}

Immunofluorescence - LRG1 Rabbit pAb (A7850)

Immunofluorescence analysis of paraffin-embedded rat liver using LRG1 Rabbit pAb (A7850) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - LRG1 Rabbit pAb (A7850)}

Immunofluorescence - LRG1 Rabbit pAb (A7850)

Immunofluorescence analysis of paraffin-embedded human liver using LRG1 Rabbit pAb (A7850) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - LRG1 Rabbit pAb (A7850)}

Immunofluorescence - LRG1 Rabbit pAb (A7850)

Immunofluorescence analysis of paraffin-embedded mouse liver using LRG1 Rabbit pAb (A7850) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A7850 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on LRG1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to LRG1. (Distance between topics and target gene indicate popularity.) LRG1

* Data provided by citexs.com, for reference only.

Publishing research using A7850? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order