Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

LOX Rabbit pAb (A7698)

Reviews (2) Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - LOX Rabbit pAb (A7698)

Western blot analysis of extracts of various cell lines, using LOX antibody (A7698) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - LOX Rabbit pAb (A7698)

Immunofluorescence analysis of BALB-3T3 cells using LOX Rabbit pAb (A7698) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - LOX Rabbit pAb (A7698)

Immunofluorescence analysis of C6 cells using LOX Rabbit pAb (A7698) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - LOX Rabbit pAb (A7698)

Immunofluorescence analysis of U-2 OS cells using LOX Rabbit pAb (A7698) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Review
ABclonal: review for LOX Rabbit pAb(A7698)
Review
ABclonal: review for LOX Rabbit pAb(A7698)

You may also interested in:

Overview

Product name LOX Rabbit pAb
Catalog No. A7698
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the lysyl oxidase family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate a regulatory propeptide and the mature enzyme. The copper-dependent amine oxidase activity of this enzyme functions in the crosslinking of collagens and elastin, while the propeptide may play a role in tumor suppression. In addition, defects in this gene have been linked with predisposition to thoracic aortic aneurysms and dissections.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human LOX (NP_002308.2).
Sequence EFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDI
Gene ID 4015
Swiss prot P28300
Synonyms AAT10; LOX
Calculated MW 47kDa
Observed MW 47kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples 293T, A-549
Cellular location Secreted, extracellular space
Customer validation

WB (Human non small cell lung adenocarcinoma cellRattus norvegicus, Rattus norvegicus)

IHC (Human non small cell lung adenocarcinoma cell)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

LOX Rabbit pAb images

ABclonal:Western blot - LOX Rabbit pAb (A7698)}

Western blot - LOX Rabbit pAb (A7698)

Western blot analysis of extracts of various cell lines, using LOX antibody (A7698) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - LOX Rabbit pAb (A7698)}

Immunofluorescence - LOX Rabbit pAb (A7698)

Immunofluorescence analysis of BALB-3T3 cells using LOX Rabbit pAb (A7698) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - LOX Rabbit pAb (A7698)}

Immunofluorescence - LOX Rabbit pAb (A7698)

Immunofluorescence analysis of C6 cells using LOX Rabbit pAb (A7698) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - LOX Rabbit pAb (A7698)}

Immunofluorescence - LOX Rabbit pAb (A7698)

Immunofluorescence analysis of U-2 OS cells using LOX Rabbit pAb (A7698) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Submit an review for A7698

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A7698 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on LOX. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to LOX. (Distance between topics and target gene indicate popularity.) LOX

* Data provided by citexs.com, for reference only.

Publishing research using A7698? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order