Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Cytokeratin 16 (KRT16) Rabbit pAb (A7493)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Cytokeratin 16 (KRT16) Rabbit pAb (A7493)

Western blot analysis of extracts of various cell lines, using Cytokeratin 16 (KRT16) antibody (A7493) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - Cytokeratin 16 (KRT16) Rabbit pAb (A7493)

Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using Cytokeratin 16 (KRT16) Rabbit pAb (A7493) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Cytokeratin 16 (KRT16) Rabbit pAb (A7493)

Immunohistochemistry analysis of paraffin-embedded human skin using Cytokeratin 16 (KRT16) Rabbit pAb (A7493) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Cytokeratin 16 (KRT16) Rabbit pAb (A7493)

Immunofluorescence analysis of A-549 cells using Cytokeratin 16 (KRT16) Rabbit pAb (A7493) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Cytokeratin 16 (KRT16) Rabbit pAb (A7493)

Immunofluorescence analysis of rat skin using Cytokeratin 16 (KRT16) Rabbit pAb (A7493) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Cytokeratin 16 (KRT16) Rabbit pAb (A7493)

Immunofluorescence analysis of mouse skin using Cytokeratin 16 (KRT16) Rabbit pAb (A7493) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Cytokeratin 16 (KRT16) Rabbit pAb
Catalog No. A7493
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles. Mutations in this gene are associated with type 1 pachyonychia congenita, non-epidermolytic palmoplantar keratoderma and unilateral palmoplantar verrucous nevus.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 190-430 of human Cytokeratin 16 (KRT16) (NP_005548.2).
Sequence LQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLDELTLARTDLEMQIEGLKEELAYLRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKNRRDAETWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQLSMKASLENSLEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQEYQILLDVKTRLEQEIATYRRLLEGEDAHLSS
Gene ID 3868
Swiss prot P08779
Synonyms K16; PC1; CK16; K1CP; NEPPK; FNEPPK; KRT16A; Cytokeratin 16 (KRT16)
Calculated MW 51kDa
Observed MW 47kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples 293T, HepG2, SW620
Cellular location cytoskeleton, cytosol, extracellular exosome, nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Cytokeratin 16 (KRT16) Rabbit pAb images

ABclonal:Western blot - Cytokeratin 16 (KRT16) Rabbit pAb (A7493)}

Western blot - Cytokeratin 16 (KRT16) Rabbit pAb (A7493)

Western blot analysis of extracts of various cell lines, using Cytokeratin 16 (KRT16) antibody (A7493) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunohistochemistry - Cytokeratin 16 (KRT16) Rabbit pAb (A7493)}

Immunohistochemistry - Cytokeratin 16 (KRT16) Rabbit pAb (A7493)

Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using Cytokeratin 16 (KRT16) Rabbit pAb (A7493) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Cytokeratin 16 (KRT16) Rabbit pAb (A7493)}

Immunohistochemistry - Cytokeratin 16 (KRT16) Rabbit pAb (A7493)

Immunohistochemistry analysis of paraffin-embedded human skin using Cytokeratin 16 (KRT16) Rabbit pAb (A7493) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Cytokeratin 16 (KRT16) Rabbit pAb (A7493)}

Immunofluorescence - Cytokeratin 16 (KRT16) Rabbit pAb (A7493)

Immunofluorescence analysis of A-549 cells using Cytokeratin 16 (KRT16) Rabbit pAb (A7493) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Cytokeratin 16 (KRT16) Rabbit pAb (A7493)}

Immunofluorescence - Cytokeratin 16 (KRT16) Rabbit pAb (A7493)

Immunofluorescence analysis of rat skin using Cytokeratin 16 (KRT16) Rabbit pAb (A7493) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Cytokeratin 16 (KRT16) Rabbit pAb (A7493)}

Immunofluorescence - Cytokeratin 16 (KRT16) Rabbit pAb (A7493)

Immunofluorescence analysis of mouse skin using Cytokeratin 16 (KRT16) Rabbit pAb (A7493) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A7493 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KRT16. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KRT16. (Distance between topics and target gene indicate popularity.) KRT16

* Data provided by citexs.com, for reference only.

Publishing research using A7493? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order