Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Cytokeratin 14 (KRT14) Rabbit pAb (A15069)

Publications (3) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Cytokeratin 14 (KRT14) Rabbit pAb (A15069)

Western blot analysis of various lysates using Cytokeratin 14 (Cytokeratin 14 (KRT14)) Rabbit pAb (A15069) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - Cytokeratin 14 (KRT14) Rabbit pAb (A15069)

Immunohistochemistry analysis of Cytokeratin 14 (KRT14) in paraffin-embedded Rat skin using Cytokeratin 14 (KRT14) Rabbit pAb (A15069) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Cytokeratin 14 (KRT14) Rabbit pAb (A15069)

Immunohistochemistry analysis of Cytokeratin 14 (KRT14) in paraffin-embedded Mouse skin using Cytokeratin 14 (KRT14) Rabbit pAb (A15069) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Cytokeratin 14 (KRT14) Rabbit pAb (A15069)

Immunofluorescence analysis of A-431 cells using Cytokeratin 14 (KRT14) Rabbit pAb (A15069) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Cytokeratin 14 (KRT14) Rabbit pAb (A15069)

Immunofluorescence analysis of A-431 cells using Cytokeratin 14 (KRT14) Rabbit pAb (A15069) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Cytokeratin 14 (KRT14) Rabbit pAb
Catalog No. A15069
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the keratin family, the most diverse group of intermediate filaments. This gene product, a type I keratin, is usually found as a heterotetramer with two keratin 5 molecules, a type II keratin. Together they form the cytoskeleton of epithelial cells. Mutations in the genes for these keratins are associated with epidermolysis bullosa simplex. At least one pseudogene has been identified at 17p12-p11.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 371-470 of human Cytokeratin 14 (KRT14) (NP_000517.3).
Sequence AQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRT
Gene ID 3861
Swiss prot P02533
Synonyms K14; NFJ; CK14; EBS1; EBS3; EBS4; EBS1A; EBS1B; EBS1C; EBS1D; Cytokeratin 14 (KRT14)
Calculated MW 52kDa
Observed MW 52kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HepG2, Mouse brain, Rat brain
Cellular location Cytoplasm, Nucleus
Customer validation

IF (Mus musculus, Ovis aries)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Cytokeratin 14 (KRT14) Rabbit pAb images

ABclonal:Western blot - Cytokeratin 14 (KRT14) Rabbit pAb (A15069)}

Western blot - Cytokeratin 14 (KRT14) Rabbit pAb (A15069)

Western blot analysis of various lysates using Cytokeratin 14 (Cytokeratin 14 (KRT14)) Rabbit pAb (A15069) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - Cytokeratin 14 (KRT14) Rabbit pAb (A15069)}

Immunohistochemistry - Cytokeratin 14 (KRT14) Rabbit pAb (A15069)

Immunohistochemistry analysis of Cytokeratin 14 (KRT14) in paraffin-embedded Rat skin using Cytokeratin 14 (KRT14) Rabbit pAb (A15069) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Cytokeratin 14 (KRT14) Rabbit pAb (A15069)}

Immunohistochemistry - Cytokeratin 14 (KRT14) Rabbit pAb (A15069)

Immunohistochemistry analysis of Cytokeratin 14 (KRT14) in paraffin-embedded Mouse skin using Cytokeratin 14 (KRT14) Rabbit pAb (A15069) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Cytokeratin 14 (KRT14) Rabbit pAb (A15069)}

Immunofluorescence - Cytokeratin 14 (KRT14) Rabbit pAb (A15069)

Immunofluorescence analysis of A-431 cells using Cytokeratin 14 (KRT14) Rabbit pAb (A15069) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Cytokeratin 14 (KRT14) Rabbit pAb (A15069)}

Immunofluorescence - Cytokeratin 14 (KRT14) Rabbit pAb (A15069)

Immunofluorescence analysis of A-431 cells using Cytokeratin 14 (KRT14) Rabbit pAb (A15069) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A15069 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KRT14. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KRT14. (Distance between topics and target gene indicate popularity.) KRT14

* Data provided by citexs.com, for reference only.

Publishing research using A15069? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order