Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

p47phox/NCF1 Rabbit mAb (A5143)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - p47phox/NCF1 Rabbit mAb (A5143)

Western blot analysis of extracts of Raji cells, using p47phox/NCF1 Rabbit mAb (A5143) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

You may also interested in:

Overview

Product name p47phox/NCF1 Rabbit mAb
Catalog No. A5143
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1206

Background

The protein encoded by this gene is a 47 kDa cytosolic subunit of neutrophil NADPH oxidase. This oxidase is a multicomponent enzyme that is activated to produce superoxide anion. Mutations in this gene have been associated with chronic granulomatous disease.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 291-390 of human p47phox/NCF1 (P14598).
Sequence QRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPLEEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASAV
Gene ID 653361
Swiss prot P14598
Synonyms CGD1; NCF1A; NOXO2; p47phox; SH3PXD1A; p47phox/NCF1
Calculated MW 45kDa
Observed MW 47kDa

Applications

Reactivity Human
Tested applications Testing results
WB Human
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Raji
Cellular location Cytoplasm, Cytoplasmic side, Membrane, Peripheral membrane protein, Cytosol

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

p47phox/NCF1 Rabbit mAb images

ABclonal:Western blot - p47phox/NCF1 Rabbit mAb (A5143)}

Western blot - p47phox/NCF1 Rabbit mAb (A5143)

Western blot analysis of extracts of Raji cells, using p47phox/NCF1 Rabbit mAb (A5143) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Inquire About This Product

Submit your question about A5143 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NCF1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NCF1. (Distance between topics and target gene indicate popularity.) NCF1

* Data provided by citexs.com, for reference only.

Publishing research using A5143? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order