Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KD Validated] glucose-6-phosphate isomerase Rabbit mAb (A4401)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - [KD Validated] glucose-6-phosphate isomerase Rabbit mAb (A4401)

Western blot analysis of HeLa cells, using [KD Validated] glucose-6-phosphateisomerase Rabbit mAb (A4401) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Western blot - [KD Validated] glucose-6-phosphate isomerase Rabbit mAb (A4401)

Western blot analysis of extracts from wild type(WT) and glucose-6-phosphateisomerase knockdown (KD) 293T(KD) cells, using glucose-6-phosphateisomerase antibody (A4401) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

You may also interested in:

Overview

Product name [KD Validated] glucose-6-phosphate isomerase Rabbit mAb
Catalog No. A4401
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0997

Background

This gene encodes a member of the glucose phosphate isomerase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In the cytoplasm, the gene product functions as a glycolytic enzyme (glucose-6-phosphate isomerase) that interconverts glucose-6-phosphate and fructose-6-phosphate. Extracellularly, the encoded protein (also referred to as neuroleukin) functions as a neurotrophic factor that promotes survival of skeletal motor neurons and sensory neurons, and as a lymphokine that induces immunoglobulin secretion. The encoded protein is also referred to as autocrine motility factor based on an additional function as a tumor-secreted cytokine and angiogenic factor. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Glucose 6 phosphate isomerase (P06744).
Sequence MAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLH
Gene ID 2821
Swiss prot P06744
Synonyms AMF; NLK; PGI; PHI; GNPI; SA36; SA-36; [KD Validated] glucose-6-phosphate isomerase
Calculated MW 63kDa
Observed MW 60kDa

Applications

Reactivity Human
Tested applications Testing results
WB HumanRat
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T, HeLa
Cellular location Cytoplasm, Secreted

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KD Validated] glucose-6-phosphate isomerase Rabbit mAb images

ABclonal:Western blot - [KD Validated] glucose-6-phosphate isomerase Rabbit mAb (A4401)}

Western blot - [KD Validated] glucose-6-phosphate isomerase Rabbit mAb (A4401)

Western blot analysis of HeLa cells, using [KD Validated] glucose-6-phosphateisomerase Rabbit mAb (A4401) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Western blot - [KD Validated] glucose-6-phosphate isomerase Rabbit mAb (A4401)}

Western blot - [KD Validated] glucose-6-phosphate isomerase Rabbit mAb (A4401)

Western blot analysis of extracts from wild type(WT) and glucose-6-phosphateisomerase knockdown (KD) 293T(KD) cells, using glucose-6-phosphateisomerase antibody (A4401) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Inquire About This Product

Submit your question about A4401 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GPI. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GPI. (Distance between topics and target gene indicate popularity.) GPI

* Data provided by citexs.com, for reference only.

Publishing research using A4401? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order