Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

β-Catenin Rabbit pAb (A11512)

Reviews (2) Publications (10) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - β-Catenin Rabbit pAb (A11512)

Western blot analysis of various lysates, using β-Catenin Rabbit pAb (A11512) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunohistochemistry - β-Catenin Rabbit pAb (A11512)

Immunohistochemistry analysis of β-Catenin in paraffin-embedded human cervix cancer tissue using β-Catenin Rabbit pAb (A11512) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunoprecipitation - β-Catenin Rabbit pAb (A11512)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg β-Catenin antibody (A11512). Western blot was performed from the immunoprecipitate using β-Catenin antibody (A11512) at a dilution of 1:1000.

Review
ABclonal: review for β-Catenin Rabbit pAb(A11512)
Review
ABclonal: review for β-Catenin Rabbit pAb(A11512)

You may also interested in:

Overview

Product name β-Catenin Rabbit pAb
Catalog No. A11512
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 667-781 of human β-Catenin (NP_001895.1).
Sequence PQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
Gene ID 1499
Swiss prot P35222
Synonyms EVR7; CTNNB; MRD19; NEDSDV; armadillo; β-Catenin
Calculated MW 85kDa
Observed MW 92kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:20 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunoprecipitation    
Positive samples Mouse brain, Mouse lung, C6
Cellular location Cell junction, Cell membrane, Cytoplasm, Nucleus, adherens junction, centrosome, cytoskeleton, microtubule organizing center, spindle pole
Customer validation

WB (Adenocarcinoma human alveolar basal epithelial cells, rat cellsMus musculus, Danio rerio, Homo sapiens, Rattus norvegicus, Capra hircus, Mus musculus, Gallus gallus)

IHC (Homo sapiens, Rattus norvegicus)

IF (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

β-Catenin Rabbit pAb images

ABclonal:Western blot - β-Catenin Rabbit pAb (A11512)}

Western blot - β-Catenin Rabbit pAb (A11512)

Western blot analysis of various lysates, using β-Catenin Rabbit pAb (A11512) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
ABclonal:Immunohistochemistry - β-Catenin Rabbit pAb (A11512)}

Immunohistochemistry - β-Catenin Rabbit pAb (A11512)

Immunohistochemistry analysis of β-Catenin in paraffin-embedded human cervix cancer tissue using β-Catenin Rabbit pAb (A11512) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
ABclonal:Immunoprecipitation - β-Catenin Rabbit pAb (A11512)}

Immunoprecipitation - β-Catenin Rabbit pAb (A11512)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg β-Catenin antibody (A11512). Western blot was performed from the immunoprecipitate using β-Catenin antibody (A11512) at a dilution of 1:1000.

Submit an review for A11512

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A11512 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CTNNB1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CTNNB1. (Distance between topics and target gene indicate popularity.) CTNNB1

* Data provided by citexs.com, for reference only.

Publishing research using A11512? Please let us know so that we can cite the reference in this datasheet.

Antibodies (15)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order