Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

UQCC2 Rabbit pAb (A9986)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - UQCC2 Rabbit pAb (A9986)

Western blot analysis of extracts of various cell lines, using UQCC2 antibody (A9986) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - UQCC2 Rabbit pAb (A9986)

Immunohistochemistry analysis of paraffin-embedded rat spleen using UQCC2 antibody (A9986) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - UQCC2 Rabbit pAb (A9986)

Immunohistochemistry analysis of paraffin-embedded rat heart using UQCC2 antibody (A9986) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - UQCC2 Rabbit pAb (A9986)

Immunohistochemistry analysis of paraffin-embedded mouse heart using UQCC2 antibody (A9986) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name UQCC2 Rabbit pAb
Catalog No. A9986
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a nucleoid protein localized to the mitochondria inner membrane. The encoded protein affects regulation of insulin secretion, mitochondrial ATP production, and myogenesis through modulation of mitochondrial respiratory chain activity.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 14-126 of human UQCC2 (NP_115716.1).
Sequence EEWPVDETKRGRDLGAYLRQRVAQAFREGENTQVAEPEACDQMYESLARLHSNYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA
Gene ID 84300
Swiss prot Q9BRT2
Synonyms M19; Cbp6; MNF1; MC3DN7; C6orf125; C6orf126; bA6B20.2; UQCC2
Calculated MW 15kDa
Observed MW 15kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples MCF7, THP-1, HepG2, U-251MG, Mouse heart, Mouse brain, Mouse testis, Rat brain
Cellular location Mitochondrion, Mitochondrion inner membrane, Mitochondrion intermembrane space, Mitochondrion matrix, mitochondrion nucleoid

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

UQCC2 Rabbit pAb images

ABclonal:Western blot - UQCC2 Rabbit pAb (A9986)}

Western blot - UQCC2 Rabbit pAb (A9986)

Western blot analysis of extracts of various cell lines, using UQCC2 antibody (A9986) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Immunohistochemistry - UQCC2 Rabbit pAb (A9986)}

Immunohistochemistry - UQCC2 Rabbit pAb (A9986)

Immunohistochemistry analysis of paraffin-embedded rat spleen using UQCC2 antibody (A9986) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - UQCC2 Rabbit pAb (A9986)}

Immunohistochemistry - UQCC2 Rabbit pAb (A9986)

Immunohistochemistry analysis of paraffin-embedded rat heart using UQCC2 antibody (A9986) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - UQCC2 Rabbit pAb (A9986)}

Immunohistochemistry - UQCC2 Rabbit pAb (A9986)

Immunohistochemistry analysis of paraffin-embedded mouse heart using UQCC2 antibody (A9986) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A9986 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on UQCC2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to UQCC2. (Distance between topics and target gene indicate popularity.) UQCC2

* Data provided by citexs.com, for reference only.

Publishing research using A9986? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order