Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] RhoA Rabbit pAb (A15641)

KO/KDValidated

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - [KO Validated] RhoA Rabbit pAb (A15641)

Western blot analysis of extracts from normal (control) and RhoA knockout (KO) HeLa cells, using RhoA antibody (A15641) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - [KO Validated] RhoA Rabbit pAb (A15641)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using [KO Validated] RhoA Rabbit pAb (A15641) at dilution of 1:300 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - [KO Validated] RhoA Rabbit pAb (A15641)

Immunofluorescence analysis of U2OS cells using RhoA antibody (A15641) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name [KO Validated] RhoA Rabbit pAb
Catalog No. A15641
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human RhoA (NP_001655.1).
Sequence MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Gene ID 387
Swiss prot P61586
Synonyms ARHA; ARH12; RHO12; EDFAOB; RHOH12; oA
Calculated MW 22kDa
Observed MW 21kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:100 - 1:500
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa
Cellular location Cell membrane, Cell projection, Cleavage furrow, Cytoplasm, Cytoplasmic side, Lipid-anchor, Midbody, cell cortex, cytoskeleton, lamellipodium
Customer validation

WB (Rattus norvegicus, Homo sapiens)

IF (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] RhoA Rabbit pAb images

ABclonal:Western blot - [KO Validated] RhoA Rabbit pAb (A15641)}

Western blot - [KO Validated] RhoA Rabbit pAb (A15641)

Western blot analysis of extracts from normal (control) and RhoA knockout (KO) HeLa cells, using RhoA antibody (A15641) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
ABclonal:Immunohistochemistry - [KO Validated] RhoA Rabbit pAb (A15641)}

Immunohistochemistry - [KO Validated] RhoA Rabbit pAb (A15641)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using [KO Validated] RhoA Rabbit pAb (A15641) at dilution of 1:300 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - [KO Validated] RhoA Rabbit pAb (A15641)}

Immunofluorescence - [KO Validated] RhoA Rabbit pAb (A15641)

Immunofluorescence analysis of U2OS cells using RhoA antibody (A15641) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A15641 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RHOA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RHOA. (Distance between topics and target gene indicate popularity.) RHOA

* Data provided by citexs.com, for reference only.

Publishing research using A15641? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order