Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

RBBP4 Rabbit mAb (A3645)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - RBBP4 Rabbit mAb (A3645)

Western blot analysis of extracts from various cell lines, using RBBP4 Rabbit mAb (A3645) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded rat brain using RBBP4 Rabbit mAb (A3645) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using RBBP4 Rabbit mAb (A3645) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded mouse brain using RBBP4 Rabbit mAb (A3645) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded rat kidney using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded human placenta using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded mouse liver using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded human breast cancer using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded human tonsil using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded mouse intestin using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded human colon using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded human liver using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded human kidney using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - RBBP4 Rabbit mAb (A3645)

Confocal imaging of NIH/3T3 cells using RBBP4 Rabbit mAb (A3645, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Immunofluorescence - RBBP4 Rabbit mAb (A3645)

Confocal imaging of U-2 OS cells using RBBP4 Rabbit mAb (A3645, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

You may also interested in:

Overview

Product name RBBP4 Rabbit mAb
Catalog No. A3645
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0813

Background

This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RBBP4 (NP_005601.1).
Sequence MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDS
Gene ID 5928
Swiss prot Q09028
Synonyms NURF55; RBAP48; lin-53; RBBP4
Calculated MW 48kDa
Observed MW 52kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC HumanMouseRat
IHC-P HumanMouseRat
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, HepG2, SH-SY5Y, Mouse lung, Mouse spleen, Rat lung
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

RBBP4 Rabbit mAb images

ABclonal:Western blot - RBBP4 Rabbit mAb (A3645)}

Western blot - RBBP4 Rabbit mAb (A3645)

Western blot analysis of extracts from various cell lines, using RBBP4 Rabbit mAb (A3645) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)}

Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded rat brain using RBBP4 Rabbit mAb (A3645) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)}

Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using RBBP4 Rabbit mAb (A3645) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)}

Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded mouse brain using RBBP4 Rabbit mAb (A3645) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)}

Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded rat kidney using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)}

Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded human placenta using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)}

Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded mouse liver using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)}

Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)}

Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded human breast cancer using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)}

Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)}

Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded human tonsil using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)}

Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded mouse intestin using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)}

Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded human colon using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)}

Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded human liver using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - RBBP4 Rabbit mAb (A3645)}

Immunohistochemistry - RBBP4 Rabbit mAb (A3645)

Immunohistochemistry analysis of paraffin-embedded human kidney using RBBP4 Rabbit mAb (A3645) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - RBBP4 Rabbit mAb (A3645)}

Immunofluorescence - RBBP4 Rabbit mAb (A3645)

Confocal imaging of NIH/3T3 cells using RBBP4 Rabbit mAb (A3645, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
ABclonal:Immunofluorescence - RBBP4 Rabbit mAb (A3645)}

Immunofluorescence - RBBP4 Rabbit mAb (A3645)

Confocal imaging of U-2 OS cells using RBBP4 Rabbit mAb (A3645, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Inquire About This Product

Submit your question about A3645 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RBBP4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RBBP4. (Distance between topics and target gene indicate popularity.) RBBP4

* Data provided by citexs.com, for reference only.

Publishing research using A3645? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order