Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] PDK1/PDPK1 Rabbit pAb (A1665)

KO/KDValidated

Publications (4) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] PDK1/PDPK1 Rabbit pAb (A1665)

Western blot analysis of extracts of various cell lines, using PDK1/PDPK1 antibody (A1665) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Western blot - [KO Validated] PDK1/PDPK1 Rabbit pAb (A1665)

Western blot analysis of extracts from normal (control) and PDK1/PDPK1 knockout (KO) HCT116 cells, using PDK1/PDPK1 antibody (A1665) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - [KO Validated] PDK1/PDPK1 Rabbit pAb (A1665)

Immunohistochemistry analysis of paraffin-embedded rat brain using PDPK1 antibody (A1665) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name [KO Validated] PDK1/PDPK1 Rabbit pAb
Catalog No. A1665
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables 3-phosphoinositide-dependent protein kinase activity; phospholipase activator activity; and phospholipase binding activity. Involved in several processes, including cell surface receptor signaling pathway; regulation of protein kinase activity; and regulation of signal transduction. Acts upstream of or within intracellular signal transduction. Located in cell projection; cytosol; and plasma membrane. Implicated in prostate cancer. Biomarker of lung non-small cell carcinoma.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 409-556 of human PDK1/PDPK1 (NP_002604.1).
Sequence GSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ
Gene ID 5170
Swiss prot O15530
Synonyms PDK1; PDPK2; PDPK2P; PRO0461; K1
Calculated MW 63kDa
Observed MW 58-68kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HCT116, Mouse brain, Rat brain
Cellular location Cell junction, Cell membrane, Cytoplasm, Nucleus, Peripheral membrane protein, focal adhesion
Customer validation

WB (Homo sapiens, Mus musculus)

RIP (Homo sapiens)

IP (Homo sapiens, Mus musculus)

IHC (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] PDK1/PDPK1 Rabbit pAb images

ABclonal:Western blot - [KO Validated] PDK1/PDPK1 Rabbit pAb (A1665)}

Western blot - [KO Validated] PDK1/PDPK1 Rabbit pAb (A1665)

Western blot analysis of extracts of various cell lines, using PDK1/PDPK1 antibody (A1665) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Western blot - [KO Validated] PDK1/PDPK1 Rabbit pAb (A1665)}

Western blot - [KO Validated] PDK1/PDPK1 Rabbit pAb (A1665)

Western blot analysis of extracts from normal (control) and PDK1/PDPK1 knockout (KO) HCT116 cells, using PDK1/PDPK1 antibody (A1665) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - [KO Validated] PDK1/PDPK1 Rabbit pAb (A1665)}

Immunohistochemistry - [KO Validated] PDK1/PDPK1 Rabbit pAb (A1665)

Immunohistochemistry analysis of paraffin-embedded rat brain using PDPK1 antibody (A1665) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A1665 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PDPK1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PDPK1. (Distance between topics and target gene indicate popularity.) PDPK1

* Data provided by citexs.com, for reference only.

Publishing research using A1665? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order