Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

PARP1 Rabbit mAb (A19596)

Publications (15) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PARP1 Rabbit mAb (A19596)

Western blot analysis of lysates from Jurkat cells, using PARP1 Rabbit mAb (A19596) at 1:1000 dilution.Jurkat cells were treated by Staurosporine(1uM) at room temperature for 3 hours .
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - PARP1 Rabbit mAb (A19596)

Western blot analysis of various lysates using PARP1 Rabbit mAb (A19596) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded human colon using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded human liver cancer using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded human placenta using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded human spleen using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded human tonsil using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded mouse brain using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded mouse colon using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded mouse kidney using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded mouse testis using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded rat brain using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded rat heart using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded rat liver using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - PARP1 Rabbit mAb (A19596)

Immunofluorescence analysis of HeLa cells using PARP1 Rabbit mAb (A19596) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - PARP1 Rabbit mAb (A19596)

Immunofluorescence analysis of paraffin-embedded human lung using PARP1 Rabbit mAb (A19596) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name PARP1 Rabbit mAb
Catalog No. A19596
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0075

Background

This gene encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processes such as differentiation, proliferation, and tumor transformation and also in the regulation of the molecular events involved in the recovery of cell from DNA damage. In addition, this enzyme may be the site of mutation in Fanconi anemia, and may participate in the pathophysiology of type I diabetes.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 700-800 of human PARP1 (P09874).
Sequence KLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTD
Gene ID 142
Swiss prot P09874
Synonyms PARP; PARS; PPOL; ADPRT; ARTD1; ADPRT1; PARP-1; ADPRT 1; pADPRT-1; Poly-PARP; PARP1
Calculated MW 113kDa
Observed MW 89kDa/113kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC Human
IHC-P HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Jurkat+Staurosporine
Cellular location Nucleus, nucleolus
Customer validation

WB (Sanghuangporus vaninii, Homo sapiens, Rattus norvegicus, Mus musculus, Bos taurus)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PARP1 Rabbit mAb images

ABclonal:Western blot - PARP1 Rabbit mAb (A19596)}

Western blot - PARP1 Rabbit mAb (A19596)

Western blot analysis of lysates from Jurkat cells, using PARP1 Rabbit mAb (A19596) at 1:1000 dilution.Jurkat cells were treated by Staurosporine(1uM) at room temperature for 3 hours .
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - PARP1 Rabbit mAb (A19596)}

Western blot - PARP1 Rabbit mAb (A19596)

Western blot analysis of various lysates using PARP1 Rabbit mAb (A19596) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)}

Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded human colon using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)}

Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded human liver cancer using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)}

Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded human placenta using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)}

Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded human spleen using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)}

Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded human tonsil using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)}

Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded mouse brain using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)}

Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded mouse colon using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)}

Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded mouse kidney using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)}

Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded mouse testis using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)}

Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded rat brain using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)}

Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded rat heart using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PARP1 Rabbit mAb (A19596)}

Immunohistochemistry - PARP1 Rabbit mAb (A19596)

Immunohistochemistry analysis of PARP1 in paraffin-embedded rat liver using PARP1 Rabbit mAb (A19596) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - PARP1 Rabbit mAb (A19596)}

Immunofluorescence - PARP1 Rabbit mAb (A19596)

Immunofluorescence analysis of HeLa cells using PARP1 Rabbit mAb (A19596) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - PARP1 Rabbit mAb (A19596)}

Immunofluorescence - PARP1 Rabbit mAb (A19596)

Immunofluorescence analysis of paraffin-embedded human lung using PARP1 Rabbit mAb (A19596) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A19596 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PARP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PARP1. (Distance between topics and target gene indicate popularity.) PARP1

* Data provided by citexs.com, for reference only.

Publishing research using A19596? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order