Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

N-Cadherin Rabbit pAb (A0432)

Publications (10) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - N-Cadherin Rabbit pAb (A0432)

Western blot analysis of various lysates using N-Cadherin Rabbit pAb (A0432) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

You may also interested in:

Overview

Product name N-Cadherin Rabbit pAb
Catalog No. A0432
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a classical cadherin and member of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein is proteolytically processed to generate a calcium-dependent cell adhesion molecule and glycoprotein. This protein plays a role in the establishment of left-right asymmetry, development of the nervous system and the formation of cartilage and bone.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-800 of human N-Cadherin (NP_001783.2).
Sequence NPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDPANWLKIDPVNGQITTIAVLDRESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDINDNAPQVLPQEAETCETPDPNSINITALDYDIDPNAGPFAFDLPLSPVTIKRNWTITRLNGDFAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKVCQCDSNGDCTDVDRIVGAGLGTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPDTVEPDA
Gene ID 1000
Swiss prot P19022
Synonyms CDHN; NCAD; ACOGS; ADHD8; CD325; ARVD14; CDw325; N-Cadherin
Calculated MW 100kDa
Observed MW 120kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, Mouse brain, Mouse heart, Rat heart
Cellular location Cell membrane, Single-pass type I membrane protein
Customer validation

IF (Homo sapiens)

WB (Homo sapiens, Mus musculus, Rattus norvegicus)

ELISA (Homo sapiens, Mus musculus, Rattus norvegicus)

IHC (Rattus norvegicus, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

N-Cadherin Rabbit pAb images

ABclonal:Western blot - N-Cadherin Rabbit pAb (A0432)}

Western blot - N-Cadherin Rabbit pAb (A0432)

Western blot analysis of various lysates using N-Cadherin Rabbit pAb (A0432) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Inquire About This Product

Submit your question about A0432 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CDH2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CDH2. (Distance between topics and target gene indicate popularity.) CDH2

* Data provided by citexs.com, for reference only.

Publishing research using A0432? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order