Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

HDAC3 Rabbit mAb (A19537)

Publications (9) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - HDAC3 Rabbit mAb (A19537)

Western blot analysis of various lysates using HDAC3 Rabbit mAb (A19537) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.

ABclonal:Immunoprecipitation - HDAC3 Rabbit mAb (A19537)

Immunoprecipitation analysis of 300 μg extracts from HeLa cells using 3 μg HDAC3 Rabbit mAb (A19537). Western blot was performed from the immunoprecipitate using HDAC3 Rabbit mAb (A19537) at a dilution of 1:1000.

You may also interested in:

Overview

Product name HDAC3 Rabbit mAb
Catalog No. A19537
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0016

Background

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 329-428 of human HDAC3 (NP_003874.2).
Sequence FEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
Gene ID 8841
Swiss prot O15379
Synonyms HD3; RPD3; KDAC3; RPD3-2; HDAC3
Calculated MW 49kDa
Observed MW 49kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples PC-3, HeLa, Mouse brain, NIH/3T3, Rat testis
Cellular location Cytoplasm, Nucleus, cytosol
Customer validation

WB (Rattus norvegicus, Mus musculus, Homo sapiens)

CHIP (Rattus norvegicus)

IF (Mus musculus)

Co-IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

HDAC3 Rabbit mAb images

ABclonal:Western blot - HDAC3 Rabbit mAb (A19537)}

Western blot - HDAC3 Rabbit mAb (A19537)

Western blot analysis of various lysates using HDAC3 Rabbit mAb (A19537) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.
ABclonal:Immunoprecipitation - HDAC3 Rabbit mAb (A19537)}

Immunoprecipitation - HDAC3 Rabbit mAb (A19537)

Immunoprecipitation analysis of 300 μg extracts from HeLa cells using 3 μg HDAC3 Rabbit mAb (A19537). Western blot was performed from the immunoprecipitate using HDAC3 Rabbit mAb (A19537) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A19537 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on HDAC3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to HDAC3. (Distance between topics and target gene indicate popularity.) HDAC3

* Data provided by citexs.com, for reference only.

Publishing research using A19537? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order