Publications (9) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | HDAC3 Rabbit mAb |
---|---|
Catalog No. | A19537 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0016 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 329-428 of human HDAC3 (NP_003874.2). |
---|---|
Sequence | FEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI |
Gene ID | 8841 |
Swiss prot | O15379 |
Synonyms | HD3; RPD3; KDAC3; RPD3-2; HDAC3 |
Calculated MW | 49kDa |
Observed MW | 49kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | Testing results |
WB | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunoprecipitation |
Positive samples | PC-3, HeLa, Mouse brain, NIH/3T3, Rat testis |
Cellular location | Cytoplasm, Nucleus, cytosol |
Customer validation | WB (Rattus norvegicus, Mus musculus, Homo sapiens) CHIP (Rattus norvegicus) IF (Mus musculus) Co-IP (Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A19537 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on HDAC3. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to HDAC3. (Distance between topics and target gene indicate popularity.) HDAC3
* Data provided by citexs.com, for reference only.
Publishing research using A19537? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.