Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KD Validated] DNMT1 Rabbit mAb (A19679)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KD Validated] DNMT1 Rabbit mAb (A19679)

Western blot analysis of various lysates using [KD Validated] DNMT1 Rabbit mAb (A19679) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Exposure time: 30 s.

ABclonal:Western blot - [KD Validated] DNMT1 Rabbit mAb (A19679)

Western blot analysis of lysates from wild type (WT) and DNMT1 knockdown (KD) 293T cells, using [KD Validated] DNMT1 Rabbit mAb (A19679) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunoprecipitation - [KD Validated] DNMT1 Rabbit mAb (A19679)

Immunoprecipitation analysis of 300 μg extracts from Jurkat cells using 3 μg [KD Validated] DNMT1 Rabbit mAb (A19679).Western blot was performed from the immunoprecipitate using DNMT1 (A19679) at a dilution of 1:1000.

You may also interested in:

Overview

Product name [KD Validated] DNMT1 Rabbit mAb
Catalog No. A19679
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC51348

Background

This gene encodes an enzyme that transfers methyl groups to cytosine nucleotides of genomic DNA. This protein is the major enzyme responsible for maintaining methylation patterns following DNA replication and shows a preference for hemi-methylated DNA. Methylation of DNA is an important component of mammalian epigenetic gene regulation. Aberrant methylation patterns are found in human tumors and associated with developmental abnormalities. Variation in this gene has been associated with cerebellar ataxia, deafness, and narcolepsy, and neuropathy, hereditary sensory, type IE. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNMT1 (NP_001370.1).
Sequence MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYN
Gene ID 1786
Swiss prot P26358
Synonyms AIM; DNMT; MCMT; CXXC9; HSN1E; ADCADN; m.HsaI; [KD Validated] DNMT1
Calculated MW 183kDa
Observed MW 200kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB Human
Recommended dilution
  • WB 1:500 - 1:1000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples Jurkat, HeLa, 293T
Cellular location Nucleus
Customer validation

IF (Mus musculus)

WB (Gallus gallus)

CHIP (mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KD Validated] DNMT1 Rabbit mAb images

ABclonal:Western blot - [KD Validated] DNMT1 Rabbit mAb (A19679)}

Western blot - [KD Validated] DNMT1 Rabbit mAb (A19679)

Western blot analysis of various lysates using [KD Validated] DNMT1 Rabbit mAb (A19679) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Exposure time: 30 s.
ABclonal:Western blot - [KD Validated] DNMT1 Rabbit mAb (A19679)}

Western blot - [KD Validated] DNMT1 Rabbit mAb (A19679)

Western blot analysis of lysates from wild type (WT) and DNMT1 knockdown (KD) 293T cells, using [KD Validated] DNMT1 Rabbit mAb (A19679) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunoprecipitation - [KD Validated] DNMT1 Rabbit mAb (A19679)}

Immunoprecipitation - [KD Validated] DNMT1 Rabbit mAb (A19679)

Immunoprecipitation analysis of 300 μg extracts from Jurkat cells using 3 μg [KD Validated] DNMT1 Rabbit mAb (A19679).Western blot was performed from the immunoprecipitate using DNMT1 (A19679) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A19679 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on DNMT1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to DNMT1. (Distance between topics and target gene indicate popularity.) DNMT1

* Data provided by citexs.com, for reference only.

Publishing research using A19679? Please let us know so that we can cite the reference in this datasheet.

Antibodies (9)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order