Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Cytokeratin 7 (CK7) Rabbit mAb (A4357)

PathoQIHC Pathology

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Cytokeratin 7 (CK7) Rabbit mAb (A4357)

Western blot analysis of various lysates using Cytokeratin 7 (KRT7) (KRT7) Rabbit mAb (A4357) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - Cytokeratin 7 (CK7) Rabbit mAb (A4357)

Immunohistochemistry analysis of Cytokeratin 7 (CK7) in paraffin-embedded human breast using Cytokeratin 7 (KRT7) Rabbit mAb (A4357) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Cytokeratin 7 (CK7) Rabbit mAb (A4357)

Immunohistochemistry analysis of Cytokeratin 7 (CK7) in paraffin-embedded Human lung adenocarcinoma using Cytokeratin 7 (KRT7) Rabbit mAb (A4357) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Cytokeratin 7 (CK7) Rabbit mAb (A4357)

Immunohistochemistry analysis of Cytokeratin 7 (CK7) in paraffin-embedded human lung using Cytokeratin 7 (KRT7) Rabbit mAb (A4357) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Cytokeratin 7 (CK7) Rabbit mAb (A4357)

Immunofluorescence analysis of paraffin-embedded Human lung using Cytokeratin 7 (CK7) Rabbit mAb (A4357) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Cytokeratin 7 (CK7) Rabbit mAb (A4357)

Immunofluorescence analysis of paraffin-embedded Mouse lung using Cytokeratin 7 (CK7) Rabbit mAb (A4357) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Cytokeratin 7 (CK7) Rabbit mAb (A4357)

Immunofluorescence analysis of paraffin-embedded Rat lung using Cytokeratin 7 (CK7) Rabbit mAb (A4357) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Cytokeratin 7 (CK7) Rabbit mAb
Catalog No. A4357
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0978

Background

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 291-463 of human Cytokeratin 7 (KRT7) (P08729).
Sequence QAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASAS
Gene ID 3855
Swiss prot P08729
Synonyms K7; KRT7; SCL; K2C7; Cytokeratin 7 (CK7)
Calculated MW 51kDa
Observed MW 55kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC HumanMouseRat
IHC-P HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa cells, Mouse lung
Cellular location Cytoplasm
Customer validation

WB (Mus musculus)

Fluorescence in situ hybridization (Homo sapiens)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Cytokeratin 7 (CK7) Rabbit mAb images

ABclonal:Western blot - Cytokeratin 7 (CK7) Rabbit mAb (A4357)}

Western blot - Cytokeratin 7 (CK7) Rabbit mAb (A4357)

Western blot analysis of various lysates using Cytokeratin 7 (KRT7) (KRT7) Rabbit mAb (A4357) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - Cytokeratin 7 (CK7) Rabbit mAb (A4357)}

Immunohistochemistry - Cytokeratin 7 (CK7) Rabbit mAb (A4357)

Immunohistochemistry analysis of Cytokeratin 7 (CK7) in paraffin-embedded human breast using Cytokeratin 7 (KRT7) Rabbit mAb (A4357) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Cytokeratin 7 (CK7) Rabbit mAb (A4357)}

Immunohistochemistry - Cytokeratin 7 (CK7) Rabbit mAb (A4357)

Immunohistochemistry analysis of Cytokeratin 7 (CK7) in paraffin-embedded Human lung adenocarcinoma using Cytokeratin 7 (KRT7) Rabbit mAb (A4357) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Cytokeratin 7 (CK7) Rabbit mAb (A4357)}

Immunohistochemistry - Cytokeratin 7 (CK7) Rabbit mAb (A4357)

Immunohistochemistry analysis of Cytokeratin 7 (CK7) in paraffin-embedded human lung using Cytokeratin 7 (KRT7) Rabbit mAb (A4357) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Cytokeratin 7 (CK7) Rabbit mAb (A4357)}

Immunofluorescence - Cytokeratin 7 (CK7) Rabbit mAb (A4357)

Immunofluorescence analysis of paraffin-embedded Human lung using Cytokeratin 7 (CK7) Rabbit mAb (A4357) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Cytokeratin 7 (CK7) Rabbit mAb (A4357)}

Immunofluorescence - Cytokeratin 7 (CK7) Rabbit mAb (A4357)

Immunofluorescence analysis of paraffin-embedded Mouse lung using Cytokeratin 7 (CK7) Rabbit mAb (A4357) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Cytokeratin 7 (CK7) Rabbit mAb (A4357)}

Immunofluorescence - Cytokeratin 7 (CK7) Rabbit mAb (A4357)

Immunofluorescence analysis of paraffin-embedded Rat lung using Cytokeratin 7 (CK7) Rabbit mAb (A4357) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A4357 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KRT7. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KRT7. (Distance between topics and target gene indicate popularity.) KRT7

* Data provided by citexs.com, for reference only.

Publishing research using A4357? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order