Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Cytochrome C Rabbit pAb (A13430)

Publications (33) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Cytochrome C Rabbit pAb (A13430)

Western blot analysis of lysates from Mouse kidney using Cytochrome C Rabbit pAb(A13430) at 1:500 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:90s.

ABclonal:Western blot - Cytochrome C Rabbit pAb (A13430)

Western blot analysis of various lysates using Cytochrome C Rabbit pAb (A13430) at 1:500 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Enhanced Kit (RM00021).
Exposuretime: 60s.

ABclonal:Immunohistochemistry - Cytochrome C Rabbit pAb (A13430)

Immunohistochemistry analysis of Cytochrome C in paraffin-embedded human kidney using Cytochrome C Rabbit pAb (A13430) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Cytochrome C Rabbit pAb (A13430)

Immunohistochemistry analysis of Cytochrome C in paraffin-embedded rat colon using Cytochrome C Rabbit pAb (A13430) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Cytochrome C Rabbit pAb (A13430)

Immunofluorescence analysis of HepG2 cells using Cytochrome C Rabbit pAb (A13430) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Cytochrome C Rabbit pAb (A13430)

Immunofluorescence analysis of NIH/3T3 cells using Cytochrome C Rabbit pAb (A13430) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Cytochrome C Rabbit pAb
Catalog No. A13430
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a small heme protein that functions as a central component of the electron transport chain in mitochondria. The encoded protein associates with the inner membrane of the mitochondrion where it accepts electrons from cytochrome b and transfers them to the cytochrome oxidase complex. This protein is also involved in initiation of apoptosis. Mutations in this gene are associated with autosomal dominant nonsyndromic thrombocytopenia. Numerous processed pseudogenes of this gene are found throughout the human genome.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human Cytochrome C (NP_061820.1).
Sequence MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Gene ID 54205
Swiss prot P99999
Synonyms CYC; HCS; THC4; Cytochrome C
Calculated MW 12kDa
Observed MW 14kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Mouse kidney, HeLa, 293T, C2C12, Rat kidney, C6
Cellular location Mitochondrion intermembrane space
Customer validation

WB (Mus musculus, Homo sapiens, Andrias davidianus, Giardia duodenalis, Gallus gallus, Rattus norvegicus, gga, Ctenopharyngodon idella, Ctenopharyngodon idellus)

IF (Gallus gallus, Mus musculus)

RT-PCR (Ctenopharyngodon idellus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Cytochrome C Rabbit pAb images

ABclonal:Western blot - Cytochrome C Rabbit pAb (A13430)}

Western blot - Cytochrome C Rabbit pAb (A13430)

Western blot analysis of lysates from Mouse kidney using Cytochrome C Rabbit pAb(A13430) at 1:500 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:90s.
ABclonal:Western blot - Cytochrome C Rabbit pAb (A13430)}

Western blot - Cytochrome C Rabbit pAb (A13430)

Western blot analysis of various lysates using Cytochrome C Rabbit pAb (A13430) at 1:500 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Enhanced Kit (RM00021).
Exposuretime: 60s.
ABclonal:Immunohistochemistry - Cytochrome C Rabbit pAb (A13430)}

Immunohistochemistry - Cytochrome C Rabbit pAb (A13430)

Immunohistochemistry analysis of Cytochrome C in paraffin-embedded human kidney using Cytochrome C Rabbit pAb (A13430) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Cytochrome C Rabbit pAb (A13430)}

Immunohistochemistry - Cytochrome C Rabbit pAb (A13430)

Immunohistochemistry analysis of Cytochrome C in paraffin-embedded rat colon using Cytochrome C Rabbit pAb (A13430) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Cytochrome C Rabbit pAb (A13430)}

Immunofluorescence - Cytochrome C Rabbit pAb (A13430)

Immunofluorescence analysis of HepG2 cells using Cytochrome C Rabbit pAb (A13430) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Cytochrome C Rabbit pAb (A13430)}

Immunofluorescence - Cytochrome C Rabbit pAb (A13430)

Immunofluorescence analysis of NIH/3T3 cells using Cytochrome C Rabbit pAb (A13430) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A13430 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CYCS. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CYCS. (Distance between topics and target gene indicate popularity.) CYCS

* Data provided by citexs.com, for reference only.

Publishing research using A13430? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order