Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] Caspase-3 p17 Rabbit pAb (A21677)

KO/KDValidated

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)

Western blot analysis of extracts of Mouse lung, using Caspase-3 p17 antibody (A21677) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)

Western blot analysis of extracts of Jurkat cells, using Caspase-3 p17 antibody (A21677) at 1:1000 dilution.Jurkat cells were treated by staurosporine(1 uM) for 3 hour.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)

Western blot analysis of extracts from wild type(WT) and Caspase-3 p17 knockout (KO) 293T cells, using Caspase-3 p17 antibody (A21677) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using [KO Validated] Caspase-3 p17 Rabbit pAb (A21677) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)

Immunohistochemistry analysis of paraffin-embedded rat spleen using [KO Validated] Caspase-3 p17 Rabbit pAb (A21677) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)

Immunofluorescence analysis of L929 cells using Caspase-3 p17 Rabbit pAb (A21677) at dilution of 1:100. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)

Immunofluorescence analysis of NIH/3T3 cells using Caspase-3 p17 Rabbit pAb (A21677) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)

Immunofluorescence analysis of PC-12 cells using Caspase-3 p17 Rabbit pAb (A21677) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)

Immunofluorescence analysis of U2OS cells using Caspase-3 p17 Rabbit pAb (A21677) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name [KO Validated] Caspase-3 p17 Rabbit pAb
Catalog No. A21677
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-175 of human Caspase-3 (NP_004337.2).
Sequence SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
Gene ID 836
Swiss prot P42574
Synonyms CPP32; SCA-1; CPP32B; 17
Calculated MW 32kDa
Observed MW 32kDa/17kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples 293T, Jurkat, Mouse lung
Cellular location Cytoplasm
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] Caspase-3 p17 Rabbit pAb images

ABclonal:Western blot - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)}

Western blot - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)

Western blot analysis of extracts of Mouse lung, using Caspase-3 p17 antibody (A21677) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)}

Western blot - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)

Western blot analysis of extracts of Jurkat cells, using Caspase-3 p17 antibody (A21677) at 1:1000 dilution.Jurkat cells were treated by staurosporine(1 uM) for 3 hour.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)}

Western blot - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)

Western blot analysis of extracts from wild type(WT) and Caspase-3 p17 knockout (KO) 293T cells, using Caspase-3 p17 antibody (A21677) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)}

Immunohistochemistry - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using [KO Validated] Caspase-3 p17 Rabbit pAb (A21677) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)}

Immunohistochemistry - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)

Immunohistochemistry analysis of paraffin-embedded rat spleen using [KO Validated] Caspase-3 p17 Rabbit pAb (A21677) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)}

Immunofluorescence - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)

Immunofluorescence analysis of L929 cells using Caspase-3 p17 Rabbit pAb (A21677) at dilution of 1:100. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)}

Immunofluorescence - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)

Immunofluorescence analysis of NIH/3T3 cells using Caspase-3 p17 Rabbit pAb (A21677) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)}

Immunofluorescence - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)

Immunofluorescence analysis of PC-12 cells using Caspase-3 p17 Rabbit pAb (A21677) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)}

Immunofluorescence - [KO Validated] Caspase-3 p17 Rabbit pAb (A21677)

Immunofluorescence analysis of U2OS cells using Caspase-3 p17 Rabbit pAb (A21677) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A21677 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CASP3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CASP3. (Distance between topics and target gene indicate popularity.) CASP3

* Data provided by citexs.com, for reference only.

Publishing research using A21677? Please let us know so that we can cite the reference in this datasheet.

Antibodies (11)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order