Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Caspase-3 p12 Rabbit mAb (A19664)

Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Caspase-3 p12 Rabbit mAb (A19664)

Western blot analysis of extracts of various cell lines, using Caspase-3 p12 antibody (A19664) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - Caspase-3 p12 Rabbit mAb (A19664)

Immunohistochemistry analysis of paraffin-embedded rat spleen using Caspase-3 p12 antibody (A19664) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Caspase-3 p12 Rabbit mAb (A19664)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using Caspase-3 p12 antibody (A19664) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Caspase-3 p12 Rabbit mAb (A19664)

Immunofluorescence analysis of HeLa cells using Caspase-3 p12 antibody (A19664).HeLa cells were treated by Etoposide (25 uM) at 37℃ for 5 hours. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Caspase-3 p12 Rabbit mAb
Catalog No. A19664
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0143

Background

The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 176-277 of human Caspase-3 p12 (P42574).
Sequence SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Gene ID 836
Swiss prot P42574
Synonyms CPP32; SCA-1; CPP32B; Caspase-3 p12
Calculated MW 32kDa
Observed MW 12kDa/30kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC Human
IHC-P HumanRat
WB MouseRat
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Mouse liver, NIH/3T3, Rat spleen, Rat liver
Cellular location Cytoplasm
Customer validation

WB (Rattus norvegicus, Homo sapiens, Cyprinus carpio)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Caspase-3 p12 Rabbit mAb images

ABclonal:Western blot - Caspase-3 p12 Rabbit mAb (A19664)}

Western blot - Caspase-3 p12 Rabbit mAb (A19664)

Western blot analysis of extracts of various cell lines, using Caspase-3 p12 antibody (A19664) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
ABclonal:Immunohistochemistry - Caspase-3 p12 Rabbit mAb (A19664)}

Immunohistochemistry - Caspase-3 p12 Rabbit mAb (A19664)

Immunohistochemistry analysis of paraffin-embedded rat spleen using Caspase-3 p12 antibody (A19664) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Caspase-3 p12 Rabbit mAb (A19664)}

Immunohistochemistry - Caspase-3 p12 Rabbit mAb (A19664)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using Caspase-3 p12 antibody (A19664) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Caspase-3 p12 Rabbit mAb (A19664)}

Immunofluorescence - Caspase-3 p12 Rabbit mAb (A19664)

Immunofluorescence analysis of HeLa cells using Caspase-3 p12 antibody (A19664).HeLa cells were treated by Etoposide (25 uM) at 37℃ for 5 hours. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A19664 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CASP3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CASP3. (Distance between topics and target gene indicate popularity.) CASP3

* Data provided by citexs.com, for reference only.

Publishing research using A19664? Please let us know so that we can cite the reference in this datasheet.

Antibodies (11)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order