Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

CD63 Rabbit mAb (A19023)

PathoQIHC Pathology

Publications (29) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CD63 Rabbit mAb (A19023)

Western blot analysis of lysates from A375 cells, using CD63 Rabbit mAb (A19023) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - CD63 Rabbit mAb (A19023)

Western blot analysis of various lysates, using CD63 Rabbit mAb (A19023) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunohistochemistry - CD63 Rabbit mAb (A19023)

Immunohistochemistry analysis of CD63 in paraffin-embedded human colon using CD63 Rabbit mAb (A19023) at dilution of 1:10000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CD63 Rabbit mAb (A19023)

Immunohistochemistry analysis of CD63 in paraffin-embedded human tonsil using CD63 Rabbit mAb (A19023) at dilution of 1:10000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name CD63 Rabbit mAb
Catalog No. A19023
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC51703

Background

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 103-203 of human CD63 (NP_001771.1).
Sequence AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV
Gene ID 967
Swiss prot P08962
Synonyms MLA1; ME491; LAMP-3; OMA81H; TSPAN30; CD63
Calculated MW 17kDa/23kDa/25kDa
Observed MW 30-65kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IHC-P HumanRat
WB HumanMouse
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:2000 - 1:10000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples A375, RAW 264.7, Mouse kidney
Cellular location Cell membrane, Endosome, Late endosome membrane, Lysosome membrane, Melanosome, Multi-pass membrane protein, multivesicular body
Customer validation

WB (Homo sapiens, Danio rerio, Mus musculus, Canis lupus familiaris, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD63 Rabbit mAb images

ABclonal:Western blot - CD63 Rabbit mAb (A19023)}

Western blot - CD63 Rabbit mAb (A19023)

Western blot analysis of lysates from A375 cells, using CD63 Rabbit mAb (A19023) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - CD63 Rabbit mAb (A19023)}

Western blot - CD63 Rabbit mAb (A19023)

Western blot analysis of various lysates, using CD63 Rabbit mAb (A19023) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
ABclonal:Immunohistochemistry - CD63 Rabbit mAb (A19023)}

Immunohistochemistry - CD63 Rabbit mAb (A19023)

Immunohistochemistry analysis of CD63 in paraffin-embedded human colon using CD63 Rabbit mAb (A19023) at dilution of 1:10000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CD63 Rabbit mAb (A19023)}

Immunohistochemistry - CD63 Rabbit mAb (A19023)

Immunohistochemistry analysis of CD63 in paraffin-embedded human tonsil using CD63 Rabbit mAb (A19023) at dilution of 1:10000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A19023 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CD63. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CD63. (Distance between topics and target gene indicate popularity.) CD63

* Data provided by citexs.com, for reference only.

Publishing research using A19023? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order