Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

CD47 Rabbit mAb (A11382)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - CD47 Rabbit mAb (A11382)

Western blot analysis of extracts of various cell lines, using CD47 antibody (A11382) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

You may also interested in:

Overview

Product name CD47 Rabbit mAb
Catalog No. A11382
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0584

Background

This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 224-323 of human CD47 (Q08722).
Sequence HYYVFSTAIGLTSFVIAILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQPPRKAVEEPLNAFKESKGMMNDE
Gene ID 961
Swiss prot Q08722
Synonyms IAP; OA3; MER6; CD47
Calculated MW 35kDa
Observed MW 50kDa

Applications

Reactivity Human, Mouse
Tested applications Testing results
WB HumanMouse
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-2 OS
Cellular location Cell membrane, Multi-pass membrane protein
Customer validation

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD47 Rabbit mAb images

ABclonal:Western blot - CD47 Rabbit mAb (A11382)}

Western blot - CD47 Rabbit mAb (A11382)

Western blot analysis of extracts of various cell lines, using CD47 antibody (A11382) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Inquire About This Product

Submit your question about A11382 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CD47. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CD47. (Distance between topics and target gene indicate popularity.) CD47

* Data provided by citexs.com, for reference only.

Publishing research using A11382? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

Proteins (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order