Publications (2) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse
Product name | CD47 Rabbit mAb |
---|---|
Catalog No. | A11382 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0584 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 224-323 of human CD47 (Q08722). |
---|---|
Sequence | HYYVFSTAIGLTSFVIAILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQPPRKAVEEPLNAFKESKGMMNDE |
Gene ID | 961 |
Swiss prot | Q08722 |
Synonyms | IAP; OA3; MER6; CD47 |
Calculated MW | 35kDa |
Observed MW | 50kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | Testing results |
WB | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | U-2 OS |
Cellular location | Cell membrane, Multi-pass membrane protein |
Customer validation | WB (Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A11382 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on CD47. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to CD47. (Distance between topics and target gene indicate popularity.) CD47
* Data provided by citexs.com, for reference only.
Publishing research using A11382? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.