Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] Beclin 1 Rabbit pAb (A21695)

KO/KDValidated

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] Beclin 1 Rabbit pAb (A21695)

Western blot analysis of lysates from wild type (WT) and Beclin 1 knockout (KO) 239T cells using [KO Validated] Beclin 1 Rabbit pAb (A21695) at 1:900 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 60s.

ABclonal:Western blot - [KO Validated] Beclin 1 Rabbit pAb (A21695)

Western blot analysis of lysates from Mouse lung using [KO Validated] Beclin 1 Rabbit pAb(A21695) at 1:900 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:60s.

ABclonal:Immunohistochemistry - [KO Validated] Beclin 1 Rabbit pAb (A21695)

Immunohistochemistry analysis of Beclin 1 in paraffin-embedded human stomach using [KO Validated] Beclin 1 Rabbit pAb (A21695) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - [KO Validated] Beclin 1 Rabbit pAb (A21695)

Immunohistochemistry analysis of Beclin 1 in paraffin-embedded mouse kidney using [KO Validated] Beclin 1 Rabbit pAb (A21695) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - [KO Validated] Beclin 1 Rabbit pAb (A21695)

Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Beclin 1 Rabbit pAb (A21695) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - [KO Validated] Beclin 1 Rabbit pAb (A21695)

Immunofluorescence analysis of PC-12 cells using [KO Validated] Beclin 1 Rabbit pAb (A21695) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name [KO Validated] Beclin 1 Rabbit pAb
Catalog No. A21695
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This protein is thought to play a role in multiple cellular processes, including tumorigenesis, neurodegeneration and apoptosis. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Beclin 1 (NP_003757.1).
Sequence MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSG
Gene ID 8678
Swiss prot Q14457
Synonyms ATG6; VPS30; beclin1; 1
Calculated MW 52kDa
Observed MW 60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:100
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples 239T, Mouse lung
Cellular location Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum membrane, Endosome, Endosome membrane, Golgi apparatus, Mitochondrion, Mitochondrion membrane, Nucleus, Peripheral membrane protein, autophagosome, trans-Golgi network membrane
Customer validation

WB (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] Beclin 1 Rabbit pAb images

ABclonal:Western blot - [KO Validated] Beclin 1 Rabbit pAb (A21695)}

Western blot - [KO Validated] Beclin 1 Rabbit pAb (A21695)

Western blot analysis of lysates from wild type (WT) and Beclin 1 knockout (KO) 239T cells using [KO Validated] Beclin 1 Rabbit pAb (A21695) at 1:900 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 60s.
ABclonal:Western blot - [KO Validated] Beclin 1 Rabbit pAb (A21695)}

Western blot - [KO Validated] Beclin 1 Rabbit pAb (A21695)

Western blot analysis of lysates from Mouse lung using [KO Validated] Beclin 1 Rabbit pAb(A21695) at 1:900 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:60s.
ABclonal:Immunohistochemistry - [KO Validated] Beclin 1 Rabbit pAb (A21695)}

Immunohistochemistry - [KO Validated] Beclin 1 Rabbit pAb (A21695)

Immunohistochemistry analysis of Beclin 1 in paraffin-embedded human stomach using [KO Validated] Beclin 1 Rabbit pAb (A21695) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] Beclin 1 Rabbit pAb (A21695)}

Immunohistochemistry - [KO Validated] Beclin 1 Rabbit pAb (A21695)

Immunohistochemistry analysis of Beclin 1 in paraffin-embedded mouse kidney using [KO Validated] Beclin 1 Rabbit pAb (A21695) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - [KO Validated] Beclin 1 Rabbit pAb (A21695)}

Immunofluorescence - [KO Validated] Beclin 1 Rabbit pAb (A21695)

Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Beclin 1 Rabbit pAb (A21695) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - [KO Validated] Beclin 1 Rabbit pAb (A21695)}

Immunofluorescence - [KO Validated] Beclin 1 Rabbit pAb (A21695)

Immunofluorescence analysis of PC-12 cells using [KO Validated] Beclin 1 Rabbit pAb (A21695) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A21695 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on BECN1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to BECN1. (Distance between topics and target gene indicate popularity.) BECN1

* Data provided by citexs.com, for reference only.

Publishing research using A21695? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order