Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] KMT5C Rabbit pAb (A16235)

KO/KDValidated

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - [KO Validated] KMT5C Rabbit pAb (A16235)

Western blot analysis of various lysates using [KO Validated] KMT5C Rabbit pAb (A16235) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - [KO Validated] KMT5C Rabbit pAb (A16235)

Western blot analysis of lysates from Mouse thymus, using [KO Validated] KMT5C Rabbit pAb (A16235) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Western blot - [KO Validated] KMT5C Rabbit pAb (A16235)

Western blot analysis of lysates from wild type (WT) and KMT5C knockout (KO) 293T cells, using [KO Validated] KMT5C Rabbit pAb (A16235) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

You may also interested in:

Overview

Product name [KO Validated] KMT5C Rabbit pAb
Catalog No. A16235
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

SUV420H2 and the related enzyme SUV420H1 (MIM 610881) function as histone methyltransferases that specifically trimethylate nucleosomal histone H4 (see MIM 602822) on lysine-20 (K20) (Schotta et al., 2004 [PubMed 15145825]).

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KMT5C (NP_116090.2).
Sequence FLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGNAAC
Gene ID 84787
Swiss prot Q86Y97
Synonyms SUV420H2; Suv4-20h2; 5C
Calculated MW 52kDa
Observed MW 52kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, 293T, Jurkat, Mouse thymus
Cellular location Chromosome, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] KMT5C Rabbit pAb images

ABclonal:Western blot - [KO Validated] KMT5C Rabbit pAb (A16235)}

Western blot - [KO Validated] KMT5C Rabbit pAb (A16235)

Western blot analysis of various lysates using [KO Validated] KMT5C Rabbit pAb (A16235) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - [KO Validated] KMT5C Rabbit pAb (A16235)}

Western blot - [KO Validated] KMT5C Rabbit pAb (A16235)

Western blot analysis of lysates from Mouse thymus, using [KO Validated] KMT5C Rabbit pAb (A16235) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Western blot - [KO Validated] KMT5C Rabbit pAb (A16235)}

Western blot - [KO Validated] KMT5C Rabbit pAb (A16235)

Western blot analysis of lysates from wild type (WT) and KMT5C knockout (KO) 293T cells, using [KO Validated] KMT5C Rabbit pAb (A16235) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Inquire About This Product

Submit your question about A16235 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KMT5C. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KMT5C. (Distance between topics and target gene indicate popularity.) KMT5C

* Data provided by citexs.com, for reference only.

Publishing research using A16235? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order