Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

KL Rabbit pAb (A12028)

Publications (9) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - KL Rabbit pAb (A12028)

Western blot analysis of various lysates using KL Rabbit pAb (A12028) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

You may also interested in:

Overview

Product name KL Rabbit pAb
Catalog No. A12028
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a type-I membrane protein that is related to beta-glucosidases. Reduced production of this protein has been observed in patients with chronic renal failure (CRF), and this may be one of the factors underlying the degenerative processes (e.g., arteriosclerosis, osteoporosis, and skin atrophy) seen in CRF. Also, mutations within this protein have been associated with ageing and bone loss.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human KL (NP_004786.2).
Sequence MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLRAEPGDGAQTWARFSRPPAPEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRL
Gene ID 9365
Swiss prot Q9UEF7
Synonyms KLA; HFTC3; KL
Calculated MW 116kDa
Observed MW 65kDa, 120kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples DU145, Mouse kidney, Mouse brain, Rat kidney
Cellular location Cell membrane, Secreted, Single-pass type I membrane protein
Customer validation

WB (Mus musculus, Rattus norvegicus, Homo sapiens)

IHC (Mus musculus)

IF (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

KL Rabbit pAb images

ABclonal:Western blot - KL Rabbit pAb (A12028)}

Western blot - KL Rabbit pAb (A12028)

Western blot analysis of various lysates using KL Rabbit pAb (A12028) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Inquire About This Product

Submit your question about A12028 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KL. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KL. (Distance between topics and target gene indicate popularity.) KL

* Data provided by citexs.com, for reference only.

Publishing research using A12028? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order