Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

KLK12 Rabbit pAb (A16523)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - KLK12 Rabbit pAb (A16523)

Western blot analysis of lysates from HeLa cells, using KLK12 Rabbit pAb (A16523) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

You may also interested in:

Overview

Product name KLK12 Rabbit pAb
Catalog No. A16523
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing of this gene results in three transcript variants encoding different isoforms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 18-150 of human KLK12 (NP_062544.1).
Sequence ATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGSRYWVRLGEHSLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPNDCATAGTECHVSGWGITNH
Gene ID 43849
Swiss prot Q9UKR0
Synonyms KLKL5; KLK-L5; KLK12
Calculated MW 27kDa
Observed MW 28kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa
Cellular location Secreted

Research Area

KLK12 Rabbit pAb images

ABclonal:Western blot - KLK12 Rabbit pAb (A16523)}

Western blot - KLK12 Rabbit pAb (A16523)

Western blot analysis of lysates from HeLa cells, using KLK12 Rabbit pAb (A16523) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Inquire About This Product

Submit your question about A16523 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KLK12. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KLK12. (Distance between topics and target gene indicate popularity.) KLK12

* Data provided by citexs.com, for reference only.

Publishing research using A16523? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order