Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

KIR2DL3 Rabbit pAb (A1698)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - KIR2DL3 Rabbit pAb (A1698)

Western blot analysis of extracts of various cell lines, using KIR2DL3 antibody (A1698) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - KIR2DL3 Rabbit pAb (A1698)

Immunofluorescence analysis of HepG2 cells using KIR2DL3 antibody (A1698). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name KIR2DL3 Rabbit pAb
Catalog No. A1698
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-245 of human KIR2DL3 (NP_056952.2).
Sequence HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH
Gene ID 3804
Swiss prot P43628
Synonyms p58; NKAT; GL183; NKAT2; CD158b; KIR2DL; NKAT2A; NKAT2B; CD158B2; KIR-K7b; KIR-K7c; KIR2DS5; KIRCL23; KIR-023GB; KIR2DL3
Calculated MW 38kDa
Observed MW 45kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HepG2, Mouse liver, Mouse kidney, Mouse heart
Cellular location Cell membrane, Single-pass type I membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

KIR2DL3 Rabbit pAb images

ABclonal:Western blot - KIR2DL3 Rabbit pAb (A1698)}

Western blot - KIR2DL3 Rabbit pAb (A1698)

Western blot analysis of extracts of various cell lines, using KIR2DL3 antibody (A1698) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
ABclonal:Immunofluorescence - KIR2DL3 Rabbit pAb (A1698)}

Immunofluorescence - KIR2DL3 Rabbit pAb (A1698)

Immunofluorescence analysis of HepG2 cells using KIR2DL3 antibody (A1698). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A1698 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KIR2DL3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KIR2DL3. (Distance between topics and target gene indicate popularity.) KIR2DL3

* Data provided by citexs.com, for reference only.

Publishing research using A1698? Please let us know so that we can cite the reference in this datasheet.

Proteins (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order