Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

KHDRBS2 Rabbit pAb (A15969)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Immunofluorescence - KHDRBS2 Rabbit pAb (A15969)

Immunofluorescence analysis of U2OS cells using KHDRBS2 Rabbit pAb (A15969) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name KHDRBS2 Rabbit pAb
Catalog No. A15969
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable mRNA binding activity and poly(A) binding activity. Predicted to be involved in regulation of alternative mRNA splicing, via spliceosome. Predicted to be located in nucleoplasm. Predicted to be active in nucleus.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human KHDRBS2 (NP_689901.2).
Sequence TAPSRGRGGAIPPPPPPGRGVLTPRGSTVTRGALPVPPVARGVPTPRARGAPTVPGYRAPPPPAHEAYEEYGYDDGYGGEYDDQTYETYDNSYATQTQSVPEYYDYGHGVSEDAYDSYAPEEWATTRSSLKAPPQRSARGGYREHPYGRY
Gene ID 202559
Swiss prot Q5VWX1
Synonyms SLM1; SLM-1; KHDRBS2
Calculated MW 39kDa
Observed MW

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Immunofluorescence    
Positive samples
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

KHDRBS2 Rabbit pAb images

ABclonal:Immunofluorescence - KHDRBS2 Rabbit pAb (A15969)}

Immunofluorescence - KHDRBS2 Rabbit pAb (A15969)

Immunofluorescence analysis of U2OS cells using KHDRBS2 Rabbit pAb (A15969) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A15969 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KHDRBS2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KHDRBS2. (Distance between topics and target gene indicate popularity.) KHDRBS2

* Data provided by citexs.com, for reference only.

Publishing research using A15969? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order