Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

KEAP1 Rabbit pAb (A11258)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - KEAP1 Rabbit pAb (A11258)

Western blot analysis of various lysates using KEAP1 Rabbit pAb (A11258) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunofluorescence - KEAP1 Rabbit pAb (A11258)

Immunofluorescence analysis of U2OS cells using KEAP1 Rabbit pAb (A11258) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name KEAP1 Rabbit pAb
Catalog No. A11258
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 320-510 of human KEAP1 (NP_036421.2).
Sequence RAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGA
Gene ID 9817
Swiss prot Q14145
Synonyms INrf2; KLHL19; KEAP1
Calculated MW 70kDa
Observed MW 60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse brain, Rat brain
Cellular location Cytoplasm, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

KEAP1 Rabbit pAb images

ABclonal:Western blot - KEAP1 Rabbit pAb (A11258)}

Western blot - KEAP1 Rabbit pAb (A11258)

Western blot analysis of various lysates using KEAP1 Rabbit pAb (A11258) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
ABclonal:Immunofluorescence - KEAP1 Rabbit pAb (A11258)}

Immunofluorescence - KEAP1 Rabbit pAb (A11258)

Immunofluorescence analysis of U2OS cells using KEAP1 Rabbit pAb (A11258) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A11258 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KEAP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KEAP1. (Distance between topics and target gene indicate popularity.) KEAP1

* Data provided by citexs.com, for reference only.

Publishing research using A11258? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order