Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

KDM4A Rabbit pAb (A12551)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Rat

You may also interested in:

Overview

Product name KDM4A Rabbit pAb
Catalog No. A12551
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of the Jumonji domain 2 (JMJD2) family and encodes a protein containing a JmjN domain, a JmjC domain, a JD2H domain, two TUDOR domains, and two PHD-type zinc fingers. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form, and as a transcriptional repressor.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 825-1064 of human KDM4A (NP_055478.2).
Sequence RFKLKCIFCKKRRKRTAGCCVQCSHGRCPTAFHVSCAQAAGVMMQPDDWPFVVFITCFRHKIPNLERAKGALQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELPKRVKSRLSVASDMRFNEIFTEKEVKQEKKRQRVINSRYREDYIEPALYRAIME
Gene ID 9682
Swiss prot O75164
Synonyms JMJD2; JHDM3A; JMJD2A; TDRD14A; KDM4A
Calculated MW 121kDa
Observed MW Refer to figures

Applications

Reactivity Human, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key
Positive samples
Cellular location Nucleus

Research Area

Inquire About This Product

Submit your question about A12551 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KDM4A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KDM4A. (Distance between topics and target gene indicate popularity.) KDM4A

* Data provided by citexs.com, for reference only.

Publishing research using A12551? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order