Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

KDM1 Rabbit pAb (A15794)

Publications (3) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - KDM1 Rabbit pAb (A15794)

Western blot analysis of various lysates using KDM1 Rabbit pAb (A15794) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - KDM1 Rabbit pAb (A15794)

Immunohistochemistry analysis of KDM1 in paraffin-embedded rat spleen using KDM1 Rabbit pAb (A15794) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - KDM1 Rabbit pAb (A15794)

Immunohistochemistry analysis of KDM1 in paraffin-embedded human esophageal using KDM1 Rabbit pAb (A15794) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - KDM1 Rabbit pAb (A15794)

Immunohistochemistry analysis of KDM1 in paraffin-embedded mouse brain using KDM1 Rabbit pAb (A15794) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - KDM1 Rabbit pAb (A15794)

Immunofluorescence analysis of HeLa cells using KDM1 Rabbit pAb (A15794) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - KDM1 Rabbit pAb (A15794)

Immunofluorescence analysis of L929 cells using KDM1 Rabbit pAb (A15794) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name KDM1 Rabbit pAb
Catalog No. A15794
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 130-380 of human KDM1 (NP_055828.2).
Sequence LSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQ
Gene ID 23028
Swiss prot O60341
Synonyms AOF2; CPRF; KDM1; LSD1; BHC110
Calculated MW 93kDa
Observed MW 110kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:100
  • IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples U-87MG, HeLa, Jurkat, Mouse liver, 293T
Cellular location Nucleus
Customer validation

WB (Homo sapiens, Mus musculus)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

KDM1 Rabbit pAb images

ABclonal:Western blot - KDM1 Rabbit pAb (A15794)}

Western blot - KDM1 Rabbit pAb (A15794)

Western blot analysis of various lysates using KDM1 Rabbit pAb (A15794) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - KDM1 Rabbit pAb (A15794)}

Immunohistochemistry - KDM1 Rabbit pAb (A15794)

Immunohistochemistry analysis of KDM1 in paraffin-embedded rat spleen using KDM1 Rabbit pAb (A15794) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - KDM1 Rabbit pAb (A15794)}

Immunohistochemistry - KDM1 Rabbit pAb (A15794)

Immunohistochemistry analysis of KDM1 in paraffin-embedded human esophageal using KDM1 Rabbit pAb (A15794) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - KDM1 Rabbit pAb (A15794)}

Immunohistochemistry - KDM1 Rabbit pAb (A15794)

Immunohistochemistry analysis of KDM1 in paraffin-embedded mouse brain using KDM1 Rabbit pAb (A15794) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - KDM1 Rabbit pAb (A15794)}

Immunofluorescence - KDM1 Rabbit pAb (A15794)

Immunofluorescence analysis of HeLa cells using KDM1 Rabbit pAb (A15794) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - KDM1 Rabbit pAb (A15794)}

Immunofluorescence - KDM1 Rabbit pAb (A15794)

Immunofluorescence analysis of L929 cells using KDM1 Rabbit pAb (A15794) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A15794 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KDM1A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KDM1A. (Distance between topics and target gene indicate popularity.) KDM1A

* Data provided by citexs.com, for reference only.

Publishing research using A15794? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order