Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

KCNN3 Rabbit pAb (A14012)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - KCNN3 Rabbit pAb (A14012)

Western blot analysis of extracts of various cell lines, using KCNN3 antibody (A14012) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

You may also interested in:

Overview

Product name KCNN3 Rabbit pAb
Catalog No. A14012
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. This gene belongs to the KCNN family of potassium channels. It encodes an integral membrane protein that forms a voltage-independent calcium-activated channel, which is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. This gene contains two CAG repeat regions in the coding sequence. It was thought that expansion of one or both of these repeats could lead to an increased susceptibility to schizophrenia or bipolar disorder, but studies indicate that this is probably not the case. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 631-731 of human KCNN3 (NP_002240.3).
Sequence LSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGTTHTPISDSPIGVSSTSFPTPYTSSSSC
Gene ID 3782
Swiss prot Q9UGI6
Synonyms SK3; ZLS3; hSK3; SKCA3; KCa2.3; KCNN3
Calculated MW 81kDa
Observed MW 50-85kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples NCI-H460, Raji, 293T, Mouse heart, Mouse liver, Mouse skeletal muscle, Rat skeletal muscle, Rat brain
Cellular location Membrane, Multi-pass membrane protein

KCNN3 Rabbit pAb images

ABclonal:Western blot - KCNN3 Rabbit pAb (A14012)}

Western blot - KCNN3 Rabbit pAb (A14012)

Western blot analysis of extracts of various cell lines, using KCNN3 antibody (A14012) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

Inquire About This Product

Submit your question about A14012 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KCNN3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KCNN3. (Distance between topics and target gene indicate popularity.) KCNN3

* Data provided by citexs.com, for reference only.

Publishing research using A14012? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order