Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | KCNN3 Rabbit pAb |
---|---|
Catalog No. | A14012 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 631-731 of human KCNN3 (NP_002240.3). |
---|---|
Sequence | LSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGTTHTPISDSPIGVSSTSFPTPYTSSSSC |
Gene ID | 3782 |
Swiss prot | Q9UGI6 |
Synonyms | SK3; ZLS3; hSK3; SKCA3; KCa2.3; KCNN3 |
Calculated MW | 81kDa |
Observed MW | 50-85kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | NCI-H460, Raji, 293T, Mouse heart, Mouse liver, Mouse skeletal muscle, Rat skeletal muscle, Rat brain |
Cellular location | Membrane, Multi-pass membrane protein |
Submit your question about A14012 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on KCNN3. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to KCNN3. (Distance between topics and target gene indicate popularity.) KCNN3
* Data provided by citexs.com, for reference only.
Publishing research using A14012? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.