Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

KCNJ8 Rabbit pAb (A10563)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - KCNJ8 Rabbit pAb (A10563)

Western blot analysis of extracts of various cell lines, using KCNJ8 antibody (A10563) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

You may also interested in:

Overview

Product name KCNJ8 Rabbit pAb
Catalog No. A10563
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. Defects in this gene may be a cause of J-wave syndromes and sudden infant death syndrome (SIDS).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 325-424 of human KCNJ8 (NP_004973.1).
Sequence VSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDEKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGNQNTSES
Gene ID 3764
Swiss prot Q15842
Synonyms KIR6.1; uKATP-1; KCNJ8
Calculated MW 48kDa
Observed MW 48kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-251MG, K-562, SW480
Cellular location Membrane, Multi-pass membrane protein

Research Area

KCNJ8 Rabbit pAb images

ABclonal:Western blot - KCNJ8 Rabbit pAb (A10563)}

Western blot - KCNJ8 Rabbit pAb (A10563)

Western blot analysis of extracts of various cell lines, using KCNJ8 antibody (A10563) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Inquire About This Product

Submit your question about A10563 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KCNJ8. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KCNJ8. (Distance between topics and target gene indicate popularity.) KCNJ8

* Data provided by citexs.com, for reference only.

Publishing research using A10563? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order