Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

KCNJ3 Rabbit pAb (A12455)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - KCNJ3 Rabbit pAb (A12455)

Western blot analysis of extracts of MCF7 cells, using KCNJ3 antibody (A12455) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Western blot - KCNJ3 Rabbit pAb (A12455)

Western blot analysis of extracts of mouse brain, using KCNJ3 antibody (A12455) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.

You may also interested in:

Overview

Product name KCNJ3 Rabbit pAb
Catalog No. A12455
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins and plays an important role in regulating heartbeat. It associates with three other G-protein-activated potassium channels to form a heteromultimeric pore-forming complex that also couples to neurotransmitter receptors in the brain and whereby channel activation can inhibit action potential firing by hyperpolarizing the plasma membrane. These multimeric G-protein-gated inwardly-rectifying potassium (GIRK) channels may play a role in the pathophysiology of epilepsy, addiction, Down's syndrome, ataxia, and Parkinson's disease. Alternative splicing results in multiple transcript variants encoding distinct proteins.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ3 (NP_002230.1).
Sequence NGRCNVQHGNLGSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNYTPCVANVYNFPSAFLFFIETEATIGYGYRY
Gene ID 3760
Swiss prot P48549
Synonyms KGA; GIRK1; KIR3.1; KCNJ3
Calculated MW 57kDa
Observed MW 60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples MCF7, Mouse brain
Cellular location Membrane, Multi-pass membrane protein

Research Area

KCNJ3 Rabbit pAb images

ABclonal:Western blot - KCNJ3 Rabbit pAb (A12455)}

Western blot - KCNJ3 Rabbit pAb (A12455)

Western blot analysis of extracts of MCF7 cells, using KCNJ3 antibody (A12455) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
ABclonal:Western blot - KCNJ3 Rabbit pAb (A12455)}

Western blot - KCNJ3 Rabbit pAb (A12455)

Western blot analysis of extracts of mouse brain, using KCNJ3 antibody (A12455) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.

Inquire About This Product

Submit your question about A12455 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KCNJ3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KCNJ3. (Distance between topics and target gene indicate popularity.) KCNJ3

* Data provided by citexs.com, for reference only.

Publishing research using A12455? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order