Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

KCNE1 Rabbit pAb (A14009)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

You may also interested in:

Overview

Product name KCNE1 Rabbit pAb
Catalog No. A14009
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human KCNE1 (NP_001121142.1).
Sequence MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRS
Gene ID 3753
Swiss prot P15382
Synonyms ISK; JLNS; LQT5; MinK; JLNS2; LQT2/5; KCNE1
Calculated MW 15kDa
Observed MW

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key
Positive samples
Cellular location Cell membrane, Single-pass type I membrane protein

Research Area

Inquire About This Product

Submit your question about A14009 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KCNE1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KCNE1. (Distance between topics and target gene indicate popularity.) KCNE1

* Data provided by citexs.com, for reference only.

Publishing research using A14009? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order