Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

KAT2B/PCAF Rabbit pAb (A0066)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - KAT2B/PCAF Rabbit pAb (A0066)

Western blot analysis of various lysates, using KAT2B/PCAF Rabbit pAb (A0066) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - KAT2B/PCAF Rabbit pAb (A0066)

Immunofluorescence analysis of U2OS cells using KAT2B/PCAF Rabbit pAb (A0066) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name KAT2B/PCAF Rabbit pAb
Catalog No. A0066
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human KAT2B/PCAF (NP_003875.3).
Sequence MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAAAGTAEGPGGGGSARIAVKKAQLRSAP
Gene ID 8850
Swiss prot Q92831
Synonyms CAF; PCAF; P/CAF; KAT2B/PCAF
Calculated MW 93kDa
Observed MW 93kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse Heart, Rat Heart
Cellular location Nucleus
Customer validation

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

KAT2B/PCAF Rabbit pAb images

ABclonal:Western blot - KAT2B/PCAF Rabbit pAb (A0066)}

Western blot - KAT2B/PCAF Rabbit pAb (A0066)

Western blot analysis of various lysates, using KAT2B/PCAF Rabbit pAb (A0066) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - KAT2B/PCAF Rabbit pAb (A0066)}

Immunofluorescence - KAT2B/PCAF Rabbit pAb (A0066)

Immunofluorescence analysis of U2OS cells using KAT2B/PCAF Rabbit pAb (A0066) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A0066 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KAT2B. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KAT2B. (Distance between topics and target gene indicate popularity.) KAT2B

* Data provided by citexs.com, for reference only.

Publishing research using A0066? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order