Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

AIF1/IBA1 Rabbit pAb (A12391)

Publications (8) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - AIF1/IBA1 Rabbit pAb (A12391)

Western blot analysis of lysates from THP-1 cells, using AIF1/IBA1 Rabbit pAb (A12391) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - AIF1/IBA1 Rabbit pAb (A12391)

Immunofluorescence analysis of paraffin-embedded rat brain using AIF1/IBA1 Rabbit pAb (A12391) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name AIF1/IBA1 Rabbit pAb
Catalog No. A12391
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human AIF1/IBA1 (NP_001614.3).
Sequence MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
Gene ID 199
Swiss prot P55008
Synonyms IBA1; IRT1; AIF-1; IRT-1; AIF1/IBA1
Calculated MW 17kDa
Observed MW 17kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples THP-1
Cellular location Cell projection, Cytoplasm, Cytoplasmic side, Peripheral membrane protein, cytoskeleton, ruffle membrane
Customer validation

WB (Mus musculus)

IF (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

AIF1/IBA1 Rabbit pAb images

ABclonal:Western blot - AIF1/IBA1 Rabbit pAb (A12391)}

Western blot - AIF1/IBA1 Rabbit pAb (A12391)

Western blot analysis of lysates from THP-1 cells, using AIF1/IBA1 Rabbit pAb (A12391) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - AIF1/IBA1 Rabbit pAb (A12391)}

Immunofluorescence - AIF1/IBA1 Rabbit pAb (A12391)

Immunofluorescence analysis of paraffin-embedded rat brain using AIF1/IBA1 Rabbit pAb (A12391) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A12391 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on AIF1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to AIF1. (Distance between topics and target gene indicate popularity.) AIF1

* Data provided by citexs.com, for reference only.

Publishing research using A12391? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order