Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ITK Rabbit pAb (A12682)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - ITK Rabbit pAb (A12682)

Western blot analysis of extracts of MCF-7 cells, using ITK antibody (A12682) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name ITK Rabbit pAb
Catalog No. A12682
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes an intracellular tyrosine kinase expressed in T-cells. The protein contains both SH2 and SH3 domains which are often found in intracellular kinases. It is thought to play a role in T-cell proliferation and differentiation.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 450-620 of human ITK (NP_005537.3).
Sequence QRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAESGL
Gene ID 3702
Swiss prot Q08881
Synonyms EMT; LYK; LPFS1; PSCTK2; ITK
Calculated MW 72kDa
Observed MW 72kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:3000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples MCF7
Cellular location Cytoplasm

Research Area

ITK Rabbit pAb images

ABclonal:Western blot - ITK Rabbit pAb (A12682)}

Western blot - ITK Rabbit pAb (A12682)

Western blot analysis of extracts of MCF-7 cells, using ITK antibody (A12682) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A12682 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ITK. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ITK. (Distance between topics and target gene indicate popularity.) ITK

* Data provided by citexs.com, for reference only.

Publishing research using A12682? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order