Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Integrin beta 3 (ITGB3/CD61) Rabbit pAb (A2542)

Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Integrin beta 3 (ITGB3/CD61) Rabbit pAb (A2542)

Western blot analysis of extracts of various cell lines, using Integrin beta 3 (ITGB3/CD61) antibody (A2542) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Western blot - Integrin beta 3 (ITGB3/CD61) Rabbit pAb (A2542)

Western blot analysis of extracts of HUVEC cells, using Integrin beta 3 (ITGB3/CD61) antibody (A2542) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Integrin beta 3 (ITGB3/CD61) Rabbit pAb (A2542)

Immunohistochemistry analysis of paraffin-embedded rat bone marrow using Integrin beta 3 (ITGB3/CD61) Rabbit pAb (A2542) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Integrin beta 3 (ITGB3/CD61) Rabbit pAb (A2542)

Immunohistochemistry analysis of paraffin-embedded mouse bone marrow using Integrin beta 3 (ITGB3/CD61) Rabbit pAb (A2542) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name Integrin beta 3 (ITGB3/CD61) Rabbit pAb
Catalog No. A2542
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The ITGB3 protein product is the integrin beta chain beta 3. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. Integrin beta 3 is found along with the alpha IIb chain in platelets. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-430 of human Integrin beta 3 (ITGB3/CD61) (NP_000203.2).
Sequence IEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVR
Gene ID 3690
Swiss prot P05106
Synonyms GT; GT2; CD61; GP3A; BDPLT2; GPIIIa; BDPLT16; BDPLT24; Integrin beta 3 (ITGB3/CD61)
Calculated MW 87kDa
Observed MW 100kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HUVEC, Mouse spleen, Rat lung
Cellular location Cell junction, Cell membrane, Cell projection, Single-pass type I membrane protein, focal adhesion, lamellipodium membrane
Customer validation

WB (Gallus gallus, Mus musculus, Escherichia coli, Rattus norvegicus)

IF (Mus musculus)

IHC (Escherichia coli, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Integrin beta 3 (ITGB3/CD61) Rabbit pAb images

ABclonal:Western blot - Integrin beta 3 (ITGB3/CD61) Rabbit pAb (A2542)}

Western blot - Integrin beta 3 (ITGB3/CD61) Rabbit pAb (A2542)

Western blot analysis of extracts of various cell lines, using Integrin beta 3 (ITGB3/CD61) antibody (A2542) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Western blot - Integrin beta 3 (ITGB3/CD61) Rabbit pAb (A2542)}

Western blot - Integrin beta 3 (ITGB3/CD61) Rabbit pAb (A2542)

Western blot analysis of extracts of HUVEC cells, using Integrin beta 3 (ITGB3/CD61) antibody (A2542) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - Integrin beta 3 (ITGB3/CD61) Rabbit pAb (A2542)}

Immunohistochemistry - Integrin beta 3 (ITGB3/CD61) Rabbit pAb (A2542)

Immunohistochemistry analysis of paraffin-embedded rat bone marrow using Integrin beta 3 (ITGB3/CD61) Rabbit pAb (A2542) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Integrin beta 3 (ITGB3/CD61) Rabbit pAb (A2542)}

Immunohistochemistry - Integrin beta 3 (ITGB3/CD61) Rabbit pAb (A2542)

Immunohistochemistry analysis of paraffin-embedded mouse bone marrow using Integrin beta 3 (ITGB3/CD61) Rabbit pAb (A2542) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A2542 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ITGB3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ITGB3. (Distance between topics and target gene indicate popularity.) ITGB3

* Data provided by citexs.com, for reference only.

Publishing research using A2542? Please let us know so that we can cite the reference in this datasheet.

Antibodies (8)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order