Publications (5) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | Integrin beta 3 (ITGB3/CD61) Rabbit pAb |
---|---|
Catalog No. | A2542 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 80-430 of human Integrin beta 3 (ITGB3/CD61) (NP_000203.2). |
---|---|
Sequence | IEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVR |
Gene ID | 3690 |
Swiss prot | P05106 |
Synonyms | GT; GT2; CD61; GP3A; BDPLT2; GPIIIa; BDPLT16; BDPLT24; Integrin beta 3 (ITGB3/CD61) |
Calculated MW | 87kDa |
Observed MW | 100kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry |
Positive samples | HUVEC, Mouse spleen, Rat lung |
Cellular location | Cell junction, Cell membrane, Cell projection, Single-pass type I membrane protein, focal adhesion, lamellipodium membrane |
Customer validation | WB (Gallus gallus, Mus musculus, Escherichia coli, Rattus norvegicus) IF (Mus musculus) IHC (Escherichia coli, Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A2542 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on ITGB3. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to ITGB3. (Distance between topics and target gene indicate popularity.) ITGB3
* Data provided by citexs.com, for reference only.
Publishing research using A2542? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.