Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

IQWD1 Rabbit pAb (A14286)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - IQWD1 Rabbit pAb (A14286)

Western blot analysis of various lysates using IQWD1 Rabbit pAb (A14286) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name IQWD1 Rabbit pAb
Catalog No. A14286
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a ligand-dependent coactivator of nuclear receptors, including nuclear receptor subfamily 3 group C member 1 (NR3C1), glucocorticoid receptor (GR), and androgen receptor (AR). The encoded protein and DNA damage binding protein 2 (DDB2) may act as tumor promoters and tumor suppressors, respectively, by regulating the level of androgen receptor in prostate tissues. In addition, this protein can act with glucocorticoid receptor to promote human papillomavirus gene expression.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 460-650 of human IQWD1 (NP_001017977.1).
Sequence DNNNEKLSPKPGTGEPVLSLHYSTEGTTTSTIKLNFTDEWSSIASSSRGIGSHCKSEGQEESFVPQSSVQPPEGDSETKAPEESSEDVTKYQEGVSAENPVENHINITQSDKFTAKPLDSNSGERNDLNLDRSCGVPEESASSEKAKEPETSDQTSTESATNENNTNPEPQFQTEATGPSAHEETSTRDSA
Gene ID 55827
Swiss prot Q58WW2
Synonyms NRIP; ARCAP; IQWD1; PC326; MSTP055; 1200006M05Rik
Calculated MW 96kDa
Observed MW 105kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, LO2
Cellular location Nucleus

Research Area

IQWD1 Rabbit pAb images

ABclonal:Western blot - IQWD1 Rabbit pAb (A14286)}

Western blot - IQWD1 Rabbit pAb (A14286)

Western blot analysis of various lysates using IQWD1 Rabbit pAb (A14286) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A14286 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on DCAF6. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to DCAF6. (Distance between topics and target gene indicate popularity.) DCAF6

* Data provided by citexs.com, for reference only.

Publishing research using A14286? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order