Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ING2 Rabbit pAb (A12266)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - ING2 Rabbit pAb (A12266)

Western blot analysis of extracts of various cell lines, using ING2 antibody (A12266) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name ING2 Rabbit pAb
Catalog No. A12266
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of the inhibitor of growth (ING) family. Members of the ING family associate with and modulate the activity of histone acetyltransferase (HAT) and histone deacetylase (HDAC) complexes and function in DNA repair and apoptosis. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-180 of human ING2 (NP_001555.1).
Sequence RSRLLTCYVQDYLECVESLPHDMQRNVSVLRELDNKYQETLKEIDDVYEKYKKEDDLNQKKRLQQLLQRALINSQELGDEKIQIVTQMLELVENRARQMELHSQCFQDPAESERASDKAKMDSSQPERSSRRPRRQRTSESRDLCHMANGIEDCDDQPPKE
Gene ID 3622
Swiss prot Q9H160
Synonyms ING1L; p33ING2; ING2
Calculated MW 33kDa
Observed MW 33kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples A-549, MCF7, HT-29, Mouse liver
Cellular location Nucleus

Research Area

ING2 Rabbit pAb images

ABclonal:Western blot - ING2 Rabbit pAb (A12266)}

Western blot - ING2 Rabbit pAb (A12266)

Western blot analysis of extracts of various cell lines, using ING2 antibody (A12266) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A12266 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ING2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ING2. (Distance between topics and target gene indicate popularity.) ING2

* Data provided by citexs.com, for reference only.

Publishing research using A12266? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order