Review (1)Publications (3) Datasheet
Tested applications:WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human, Mouse, Rat
Product name | IL6 Rabbit pAb |
---|---|
Catalog No. | A11114 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-212 of human IL6 (NP_000591.1). |
---|---|
Sequence | VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Gene ID | 3569 |
Swiss prot | P05231 |
Synonyms | IL6; BSF-2; BSF2; CDF; HGF; HSF; IFN-beta-2; IFNB2; IL-6 |
Calculated MW | 23kDa |
Observed MW |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Immunohistochemistry |
Positive samples | |
Cellular location | Secreted |
Customer validation | (Mouse breast cancer) IF(Mus musculus) IHC(Mus musculus) WB(Mus musculus) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A11114 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A11114? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.