Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

IL1β Rabbit mAb (A9440)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse

ABclonal:Western blot - IL1β Rabbit mAb (A9440)

Western blot analysis of extracts of Recombinant Mouse IL1β Protein, using IL1β antibody (A9440) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - IL1β Rabbit mAb (A9440)

Western blot analysis of extracts of RAW264.7 cells, using IL1β antibody (A9440) at 1:1000 dilution.Raw264.7 cells were treated by LPS (1 μg/ml) at 37℃ for 8 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

You may also interested in:

Overview

Product name IL1β Rabbit mAb
Catalog No. A9440
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC2727

Background

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1. The encoded protein plays a role in thymocyte proliferation and is involved in the inflammatory response.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-269 of mouse IL1β (P10749).
Sequence EPILCDSWDDDDNLLVCDVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
Gene ID 16176
Swiss prot P10749
Synonyms Il-1b; IL-1beta; IL1β
Calculated MW 31kDa
Observed MW 19kDa/31kDa

Applications

Reactivity Mouse
Tested applications Testing results
WB Mouse
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Recombinant Mouse IL-1 beta Protein, RAW264.7
Cellular location cytosol, extracellular region, extracellular space, lysosome

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

IL1β Rabbit mAb images

ABclonal:Western blot - IL1β Rabbit mAb (A9440)}

Western blot - IL1β Rabbit mAb (A9440)

Western blot analysis of extracts of Recombinant Mouse IL1β Protein, using IL1β antibody (A9440) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - IL1β Rabbit mAb (A9440)}

Western blot - IL1β Rabbit mAb (A9440)

Western blot analysis of extracts of RAW264.7 cells, using IL1β antibody (A9440) at 1:1000 dilution.Raw264.7 cells were treated by LPS (1 μg/ml) at 37℃ for 8 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Inquire About This Product

Submit your question about A9440 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on Il1b. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to Il1b. (Distance between topics and target gene indicate popularity.) Il1b

* Data provided by citexs.com, for reference only.

Publishing research using A9440? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Proteins (1)

Antibodies (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order