Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

IL10 Rabbit pAb (A2171)

Review (1) Publications (27) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - IL10 Rabbit pAb (A2171)

Western blot analysis of various lysates, using IL10 Rabbit pAb (A2171) at 1:800 dilution.Raw264.7 cells were treated by LPS for 6 hours and Brefeldin A for 3 hours of stimulation.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunohistochemistry - IL10 Rabbit pAb (A2171)

Immunohistochemistry analysis of IL10 in paraffin-embedded mouse spleen using IL10 Rabbit pAb (A2171) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Review
ABclonal: review for IL10 Rabbit pAb(A2171)

You may also interested in:

Overview

Product name IL10 Rabbit pAb
Catalog No. A2171
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. Mutations in this gene are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 19-178 of human IL10 (NP_000563.1).
Sequence SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Gene ID 3586
Swiss prot P22301
Synonyms CSIF; TGIF; GVHDS; IL-10; IL10A; IL10
Calculated MW 21kDa
Observed MW 18kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples RAW264.7
Cellular location Secreted
Customer validation

WB (Mouse embryonal fibroblast cellRattus norvegicus, Cynoglossus semilaevis, Mus musculus, Homo sapiens, Rattus norvegicus, Canis lupus familiaris, Capra hircus)

IF (Homo sapiens, Capra hircus)

IHC (Rattus norvegicus, Mus musculus, Homo sapiens)

FC (Canis lupus familiaris)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

IL10 Rabbit pAb images

ABclonal:Western blot - IL10 Rabbit pAb (A2171)}

Western blot - IL10 Rabbit pAb (A2171)

Western blot analysis of various lysates, using IL10 Rabbit pAb (A2171) at 1:800 dilution.Raw264.7 cells were treated by LPS for 6 hours and Brefeldin A for 3 hours of stimulation.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
ABclonal:Immunohistochemistry - IL10 Rabbit pAb (A2171)}

Immunohistochemistry - IL10 Rabbit pAb (A2171)

Immunohistochemistry analysis of IL10 in paraffin-embedded mouse spleen using IL10 Rabbit pAb (A2171) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Submit an review for A2171

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2171 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on IL10. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to IL10. (Distance between topics and target gene indicate popularity.) IL10

* Data provided by citexs.com, for reference only.

Publishing research using A2171? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Proteins (2)

ELISA Kits (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Alternative Products
Contact us to order