Review (1) Publications (27) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | IL10 Rabbit pAb |
---|---|
Catalog No. | A2171 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 19-178 of human IL10 (NP_000563.1). |
---|---|
Sequence | SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN |
Gene ID | 3586 |
Swiss prot | P22301 |
Synonyms | CSIF; TGIF; GVHDS; IL-10; IL10A; IL10 |
Calculated MW | 21kDa |
Observed MW | 18kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry |
Positive samples | RAW264.7 |
Cellular location | Secreted |
Customer validation | WB (Mouse embryonal fibroblast cellRattus norvegicus, Cynoglossus semilaevis, Mus musculus, Homo sapiens, Rattus norvegicus, Canis lupus familiaris, Capra hircus) IF (Homo sapiens, Capra hircus) IHC (Rattus norvegicus, Mus musculus, Homo sapiens) FC (Canis lupus familiaris) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A2171 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on IL10. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to IL10. (Distance between topics and target gene indicate popularity.) IL10
* Data provided by citexs.com, for reference only.
Publishing research using A2171? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.
!OUT OF STOCK
See Below for Alternatives