Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

IKKα Rabbit pAb (A0423)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - IKKα Rabbit pAb (A0423)

Western blot analysis of extracts of various cell lines, using IKKα antibody (A0423).
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

You may also interested in:

Overview

Product name IKKα Rabbit pAb
Catalog No. A0423
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-700 of human IKKα (NP_001269.3).
Sequence VLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTP
Gene ID 1147
Swiss prot O15111
Synonyms BPS2; IKK1; IKKA; IKBKA; TCF16; NFKBIKA; IKK-alpha; IKKα
Calculated MW 85kDa
Observed MW 85kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Jurkat, HeLa, HepG2
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

IKKα Rabbit pAb images

ABclonal:Western blot - IKKα Rabbit pAb (A0423)}

Western blot - IKKα Rabbit pAb (A0423)

Western blot analysis of extracts of various cell lines, using IKKα antibody (A0423).
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

Inquire About This Product

Submit your question about A0423 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CHUK. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CHUK. (Distance between topics and target gene indicate popularity.) CHUK

* Data provided by citexs.com, for reference only.

Publishing research using A0423? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order