Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

IKKβ Rabbit pAb (A2087)

Review (1) Publications (12) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Immunofluorescence - IKKβ Rabbit pAb (A2087)

Immunofluorescence analysis of NIH/3T3 cells using IKKβ Rabbit pAb (A2087) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for IKKβ Rabbit pAb(A2087)

You may also interested in:

Overview

Product name IKKβ Rabbit pAb
Catalog No. A2087
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene phosphorylates the inhibitor in the inhibitor/NF-kappa-B complex, causing dissociation of the inhibitor and activation of NF-kappa-B. The encoded protein itself is found in a complex of proteins. Several transcript variants, some protein-coding and some not, have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-669 of human IKKβ (NP_001547.1).
Sequence QISPRPQPESVSCILQEPKRNLAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLKAKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMALQTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQSFEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKIACSKVRGPV
Gene ID 3551
Swiss prot O14920
Synonyms IKK2; IKKB; IMD15; IMD15A; IMD15B; NFKBIKB; IKK-beta; IKKβ
Calculated MW 87kDa
Observed MW 87kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Mouse spleen
Cellular location Cytoplasm, Membrane raft, Nucleus
Customer validation

WB (Raw264.7Homo sapiens, Mus musculus, Rattus norvegicus, Homo sapiens)

IHC (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

IKKβ Rabbit pAb images

ABclonal:Immunofluorescence - IKKβ Rabbit pAb (A2087)}

Immunofluorescence - IKKβ Rabbit pAb (A2087)

Immunofluorescence analysis of NIH/3T3 cells using IKKβ Rabbit pAb (A2087) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A2087

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2087 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on IKBKB. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to IKBKB. (Distance between topics and target gene indicate popularity.) IKBKB

* Data provided by citexs.com, for reference only.

Publishing research using A2087? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order