Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

IGFBP3 Rabbit pAb (A16052)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - IGFBP3 Rabbit pAb (A16052)

Western blot analysis of extracts of various cell lines, using IGFBP3 antibody (A16052) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Western blot - IGFBP3 Rabbit pAb (A16052)

Western blot analysis of extracts of various cell lines, using IGFBP3 antibody (A16052) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

You may also interested in:

Overview

Product name IGFBP3 Rabbit pAb
Catalog No. A16052
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human IGFBP3 (NP_000589.2).
Sequence EARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNF
Gene ID 3486
Swiss prot P17936
Synonyms IBP3; BP-53; IGFBP3
Calculated MW 32kDa
Observed MW 40kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples A-431, 293T, Mouse kidney
Cellular location Secreted
Customer validation

IHC (Mus musculus)

qRT-PCR (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

IGFBP3 Rabbit pAb images

ABclonal:Western blot - IGFBP3 Rabbit pAb (A16052)}

Western blot - IGFBP3 Rabbit pAb (A16052)

Western blot analysis of extracts of various cell lines, using IGFBP3 antibody (A16052) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Western blot - IGFBP3 Rabbit pAb (A16052)}

Western blot - IGFBP3 Rabbit pAb (A16052)

Western blot analysis of extracts of various cell lines, using IGFBP3 antibody (A16052) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Inquire About This Product

Submit your question about A16052 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on IGFBP3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to IGFBP3. (Distance between topics and target gene indicate popularity.) IGFBP3

* Data provided by citexs.com, for reference only.

Publishing research using A16052? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order