Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

IFIH1 Rabbit pAb (A2203)

Review (1) Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - IFIH1 Rabbit pAb (A2203)

Western blot analysis of various lysates using IFIH1 Rabbit pAb (A2203) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).

ABclonal:Immunohistochemistry - IFIH1 Rabbit pAb (A2203)

Immunohistochemistry analysis of IFIH1 in paraffin-embedded human colon carcinoma using IFIH1 Rabbit pAb (A2203) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - IFIH1 Rabbit pAb (A2203)

Immunohistochemistry analysis of IFIH1 in paraffin-embedded human esophageal cancer using IFIH1 Rabbit pAb (A2203) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Review
ABclonal: review for IFIH1 Rabbit pAb(A2203)

You may also interested in:

Overview

Product name IFIH1 Rabbit pAb
Catalog No. A2203
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

IFIH1 encodes MDA5 which is an intracellular sensor of viral RNA that triggers the innate immune response. Sensing RNA length and secondary structure, MDA5 binds dsRNA oligonucleotides with a modified DExD/H-box helicase core and a C-terminal domain, thus leading to a proinflammatory response that includes interferons. It has been shown that Coronaviruses (CoVs) as well as various other virus families, are capable of evading the MDA5-dependent interferon response, thus impeding the activation of the innate immune response to infection. MDA5 has also been shown to play an important role in enhancing natural killer cell function in malaria infection. In addition to its protective role in antiviral responses, MDA5 has been implicated in autoimmune and autoinflammatory diseases such as type 1 diabetes, systemic lupus erythematosus, and Aicardi-Goutieres syndrome

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-205 of human IFIH1 (NP_071451.2).
Sequence MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSES
Gene ID 64135
Swiss prot Q9BYX4
Synonyms AGS7; Hlcd; MDA5; IMD95; MDA-5; RLR-2; IDDM19; SGMRT1; IFIH1
Calculated MW 117kDa
Observed MW 117kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples THP-1, DU145
Cellular location Cytoplasm, Nucleus
Customer validation

WB (B6)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

IFIH1 Rabbit pAb images

ABclonal:Western blot - IFIH1 Rabbit pAb (A2203)}

Western blot - IFIH1 Rabbit pAb (A2203)

Western blot analysis of various lysates using IFIH1 Rabbit pAb (A2203) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
ABclonal:Immunohistochemistry - IFIH1 Rabbit pAb (A2203)}

Immunohistochemistry - IFIH1 Rabbit pAb (A2203)

Immunohistochemistry analysis of IFIH1 in paraffin-embedded human colon carcinoma using IFIH1 Rabbit pAb (A2203) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - IFIH1 Rabbit pAb (A2203)}

Immunohistochemistry - IFIH1 Rabbit pAb (A2203)

Immunohistochemistry analysis of IFIH1 in paraffin-embedded human esophageal cancer using IFIH1 Rabbit pAb (A2203) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Submit an review for A2203

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2203 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on IFIH1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to IFIH1. (Distance between topics and target gene indicate popularity.) IFIH1

* Data provided by citexs.com, for reference only.

Publishing research using A2203? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order