Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

IDI2 Rabbit pAb (A14434)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - IDI2 Rabbit pAb (A14434)

Western blot analysis of extracts of 293T cells, using IDI2 antibody (A14434) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name IDI2 Rabbit pAb
Catalog No. A14434
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene catalyzes the conversion of isopentenyl diphosphate to dimethylallyl diphosphate, which is a precursor for the synthesis of cholesterol and other isoprenoids. This gene, which is a product of an ancestral gene duplication event, encodes a protein that may be involved in the aggregation of alpha-synuclein in the cerebral cortex of patients with Lewy body disease. In addition, segmental copy number gains in this locus have been associated with sporadic amyotrophic lateral sclerosis.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human IDI2 (NP_150286.1).
Sequence NTKNRILIQQRSDTKVTFPGYFTDSCSSHPLYNPAELEEKDAIGVRRAAQRRLQAELGIPGEQISPEDIVFMTIYHHKAKSDRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLSQEELW
Gene ID 91734
Swiss prot Q9BXS1
Synonyms IPPI2; IDI2
Calculated MW 27kDa
Observed MW 27kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T
Cellular location Peroxisome

Research Area

IDI2 Rabbit pAb images

ABclonal:Western blot - IDI2 Rabbit pAb (A14434)}

Western blot - IDI2 Rabbit pAb (A14434)

Western blot analysis of extracts of 293T cells, using IDI2 antibody (A14434) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A14434 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on IDI2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to IDI2. (Distance between topics and target gene indicate popularity.) IDI2

* Data provided by citexs.com, for reference only.

Publishing research using A14434? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order