Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ICAM-1/CD54 Rabbit pAb (A5597)

Publications (35) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - ICAM-1/CD54 Rabbit pAb (A5597)

Western blot analysis of various lysates, using ICAM-1/CD54 Rabbit pAb (A5597) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.

ABclonal:Western blot - ICAM-1/CD54 Rabbit pAb (A5597)

Western blot analysis of various lysates, using ICAM-1/CD54 Rabbit pAb (A5597) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.

ABclonal:Western blot - ICAM-1/CD54 Rabbit pAb (A5597)

Western blot analysis of lysates from Mouse lung, using ICAM-1/CD54 Rabbit pAb (A5597) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.

ABclonal:Immunohistochemistry - ICAM-1/CD54 Rabbit pAb (A5597)

Immunohistochemistry analysis of ICAM-1/CD54 in paraffin-embedded mouse lung using ICAM-1/CD54 Rabbit pAb (A5597) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ICAM-1/CD54 Rabbit pAb (A5597)

Immunohistochemistry analysis of ICAM-1/CD54 in paraffin-embedded rat lung using ICAM-1/CD54 Rabbit pAb (A5597) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ICAM-1/CD54 Rabbit pAb (A5597)

Immunohistochemistry analysis of ICAM-1/CD54 in paraffin-embedded rat spleen using ICAM-1/CD54 Rabbit pAb (A5597) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ICAM-1/CD54 Rabbit pAb (A5597)

Immunohistochemistry analysis of ICAM-1/CD54 in paraffin-embedded mouse lung using ICAM-1/CD54 Rabbit pAb (A5597) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ICAM-1/CD54 Rabbit pAb (A5597)

Immunohistochemistry analysis of ICAM-1/CD54 in paraffin-embedded rat lung using ICAM-1/CD54 Rabbit pAb (A5597) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ICAM-1/CD54 Rabbit pAb (A5597)

Immunohistochemistry analysis of ICAM-1/CD54 in paraffin-embedded rat spleen using ICAM-1/CD54 Rabbit pAb (A5597) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - ICAM-1/CD54 Rabbit pAb (A5597)

Immunofluorescence analysis of L929 cells using ICAM-1/CD54 Rabbit pAb (A5597) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name ICAM-1/CD54 Rabbit pAb
Catalog No. A5597
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 28-480 of human ICAM-1/CD54 (NP_000192.2).
Sequence QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
Gene ID 3383
Swiss prot P05362
Synonyms BB2; CD54; P3.58; ICAM-1/CD54
Calculated MW 58kDa
Observed MW 89kDa/92kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HepG2, Raji, Mouse lung
Cellular location Membrane, Single-pass type I membrane protein
Customer validation

WB (Mus musculus, Rattus norvegicus, Homo sapiens, Anatinae, Sus scrofa)

IF (Sus scrofa)

IHC (Mus musculus, Rattus norvegicus)

IF/ICC (Mus musculus)

IP (Mus musculus)

FC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ICAM-1/CD54 Rabbit pAb images

ABclonal:Western blot - ICAM-1/CD54 Rabbit pAb (A5597)}

Western blot - ICAM-1/CD54 Rabbit pAb (A5597)

Western blot analysis of various lysates, using ICAM-1/CD54 Rabbit pAb (A5597) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.
ABclonal:Western blot - ICAM-1/CD54 Rabbit pAb (A5597)}

Western blot - ICAM-1/CD54 Rabbit pAb (A5597)

Western blot analysis of various lysates, using ICAM-1/CD54 Rabbit pAb (A5597) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.
ABclonal:Western blot - ICAM-1/CD54 Rabbit pAb (A5597)}

Western blot - ICAM-1/CD54 Rabbit pAb (A5597)

Western blot analysis of lysates from Mouse lung, using ICAM-1/CD54 Rabbit pAb (A5597) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.
ABclonal:Immunohistochemistry - ICAM-1/CD54 Rabbit pAb (A5597)}

Immunohistochemistry - ICAM-1/CD54 Rabbit pAb (A5597)

Immunohistochemistry analysis of ICAM-1/CD54 in paraffin-embedded mouse lung using ICAM-1/CD54 Rabbit pAb (A5597) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ICAM-1/CD54 Rabbit pAb (A5597)}

Immunohistochemistry - ICAM-1/CD54 Rabbit pAb (A5597)

Immunohistochemistry analysis of ICAM-1/CD54 in paraffin-embedded rat lung using ICAM-1/CD54 Rabbit pAb (A5597) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ICAM-1/CD54 Rabbit pAb (A5597)}

Immunohistochemistry - ICAM-1/CD54 Rabbit pAb (A5597)

Immunohistochemistry analysis of ICAM-1/CD54 in paraffin-embedded rat spleen using ICAM-1/CD54 Rabbit pAb (A5597) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ICAM-1/CD54 Rabbit pAb (A5597)}

Immunohistochemistry - ICAM-1/CD54 Rabbit pAb (A5597)

Immunohistochemistry analysis of ICAM-1/CD54 in paraffin-embedded mouse lung using ICAM-1/CD54 Rabbit pAb (A5597) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ICAM-1/CD54 Rabbit pAb (A5597)}

Immunohistochemistry - ICAM-1/CD54 Rabbit pAb (A5597)

Immunohistochemistry analysis of ICAM-1/CD54 in paraffin-embedded rat lung using ICAM-1/CD54 Rabbit pAb (A5597) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ICAM-1/CD54 Rabbit pAb (A5597)}

Immunohistochemistry - ICAM-1/CD54 Rabbit pAb (A5597)

Immunohistochemistry analysis of ICAM-1/CD54 in paraffin-embedded rat spleen using ICAM-1/CD54 Rabbit pAb (A5597) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - ICAM-1/CD54 Rabbit pAb (A5597)}

Immunofluorescence - ICAM-1/CD54 Rabbit pAb (A5597)

Immunofluorescence analysis of L929 cells using ICAM-1/CD54 Rabbit pAb (A5597) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A5597 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ICAM1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ICAM1. (Distance between topics and target gene indicate popularity.) ICAM1

* Data provided by citexs.com, for reference only.

Publishing research using A5597? Please let us know so that we can cite the reference in this datasheet.

Antibodies (8)

ELISA Kits (1)

Proteins (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order